SecReT6
Protein ID: 345299088
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1922
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2067864..2068553 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDG2SBY2
KEGG IDeas:Entas_1922
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.00E-39, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|345299088|ref|YP_004828446.1| DotU family type IV/VI secretion system protein [Enterobacter asburiae LF7a]
MSERKRGVAASIDIDALLQDTWLQVISLRHGPTFQDGEGRTLWERCIADVECVQRELKASELDEASCQHI
LTAQCALLDEAVKGRGVEDDACVQWYDIPLQGHFLGTMDAGDTLCDRMRDVLREPAPDHAVVTCFQRVMM
LGFLGSFRSLNDPERQKLANALSEHVTPFSYPQTHPVLAESRAGRGMGGWLASWPVRIGLSVMVLVALWW
GLDHWLDQTLLTLLPGAVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2067864-2068553 Enterobacter asburiae LF7a chromosome, complete genome
ATGAGTGAGCGCAAACGCGGCGTGGCCGCGTCGATTGATATTGATGCCCTGTTGCAGGACACCTGGCTGC
AGGTGATCAGCCTGCGTCACGGTCCGACGTTTCAGGATGGAGAAGGGCGCACGCTGTGGGAGCGCTGCAT
TGCTGATGTTGAGTGCGTGCAGCGTGAGCTGAAAGCGAGCGAACTCGATGAAGCCAGTTGCCAGCATATT
CTCACTGCCCAGTGTGCACTGCTTGATGAAGCGGTCAAAGGTCGTGGTGTGGAGGATGACGCTTGTGTGC
AATGGTATGACATTCCCCTACAGGGACATTTCCTCGGCACCATGGATGCCGGTGATACGCTGTGCGATCG
AATGCGTGATGTGCTGCGTGAACCGGCGCCTGACCACGCTGTTGTCACCTGCTTTCAGCGGGTCATGATG
CTGGGGTTCCTCGGCAGTTTTCGCTCGCTGAACGATCCGGAGCGCCAAAAACTCGCCAACGCGCTCAGTG
AACATGTCACGCCGTTCAGCTATCCGCAGACTCACCCGGTACTGGCAGAAAGCCGTGCCGGGCGTGGAAT
GGGCGGCTGGCTGGCGTCATGGCCCGTGCGTATTGGCCTGAGCGTGATGGTGCTCGTCGCACTCTGGTGG
GGACTGGATCACTGGCTGGATCAGACGCTGCTGACCCTGCTACCGGGAGCCGTGAAATGA