SecReT6
Protein ID: 345299091
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1925
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2070926..2073580 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG2SBY5
KEGG IDeas:Entas_1925
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.20E-41, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 5.20E-41, Aligned region: 610..775
AAA [PF00004], Evalue: 6.00E-19, Aligned region: 238..350
AAA [PF00004], Evalue: 6.00E-19, Aligned region: 615..735
AAA [PF00004], Evalue: 6.00E-19, Aligned region: 763..780
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 336..368
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 614..735
ClpB_D2-small [PF10431], Evalue: 2.90E-13, Aligned region: 383..407
ClpB_D2-small [PF10431], Evalue: 2.90E-13, Aligned region: 487..512
ClpB_D2-small [PF10431], Evalue: 2.90E-13, Aligned region: 519..544
ClpB_D2-small [PF10431], Evalue: 2.90E-13, Aligned region: 782..855
AAA_16 [PF13191], Evalue: 9.00E-12, Aligned region: 215..259
AAA_16 [PF13191], Evalue: 9.00E-12, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 9.00E-12, Aligned region: 595..650
AAA_16 [PF13191], Evalue: 9.00E-12, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 9.00E-12, Aligned region: 753..806
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 363..402
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 611..656
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 216..253
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 290..388
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 607..635
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 684..696
IstB_IS21 [PF01695], Evalue: 1.30E-06, Aligned region: 232..295
IstB_IS21 [PF01695], Evalue: 1.30E-06, Aligned region: 494..527
IstB_IS21 [PF01695], Evalue: 1.30E-06, Aligned region: 614..632
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 238..262
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 292..326
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 488..539
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 610..643
AAA_19 [PF13245], Evalue: 2.20E-06, Aligned region: 235..261
AAA_19 [PF13245], Evalue: 2.20E-06, Aligned region: 610..636
AAA_23 [PF13476], Evalue: 5.90E-06, Aligned region: 238..255
AAA_23 [PF13476], Evalue: 5.90E-06, Aligned region: 441..535
AAA_23 [PF13476], Evalue: 5.90E-06, Aligned region: 611..638
NACHT [PF05729], Evalue: 8.70E-06, Aligned region: 238..267
NACHT [PF05729], Evalue: 8.70E-06, Aligned region: 614..635
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 601..654
AAA_17 [PF13207], Evalue: 1.70E-05, Aligned region: 238..302
AAA_17 [PF13207], Evalue: 1.70E-05, Aligned region: 613..649
Clp_N [PF02861], Evalue: 4.10E-05, Aligned region: 22..61
Clp_N [PF02861], Evalue: 4.10E-05, Aligned region: 105..122
Sigma54_activat [PF00158], Evalue: 5.20E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 5.20E-05, Aligned region: 613..731
AAA_14 [PF13173], Evalue: 8.10E-05, Aligned region: 238..328
AAA_14 [PF13173], Evalue: 8.10E-05, Aligned region: 612..696
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 610..640
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 238..258
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 615..639
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 224..255
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 613..626
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 712..733
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 238..260
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 613..645
T2SE [PF00437], Evalue: 0.004, Aligned region: 198..257
T2SE [PF00437], Evalue: 0.004, Aligned region: 485..692
ABC_tran [PF00005], Evalue: 0.0066, Aligned region: 52..121
ABC_tran [PF00005], Evalue: 0.0066, Aligned region: 238..257
ABC_tran [PF00005], Evalue: 0.0066, Aligned region: 498..533
ABC_tran [PF00005], Evalue: 0.0066, Aligned region: 613..646
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 394..411
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 613..632
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 744..792
Protein Sequence: 884 a.a.     [Download]
>gi|345299091|ref|YP_004828449.1| type VI secretion ATPase, ClpV1 family [Enterobacter asburiae LF7a]
MENPAILLRRLNPYCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDTLWQALL
GWLDNQPRSVRSRPQLSADIQKLMQEAWMQASLAGEESIRSQHLLMALTENPRLAHCDGLWPLLTLGMSQ
LSRLRPLLDAQSDERPEMQFEAELAQVHGSEVEFVGRPVGAELKEGELNPALQNALDKFTLDVTAKAKEG
KIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPESLKPVILRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSPVPILLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHNVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTAAARVRMSLDTVPEQIVRLKAQLTALALEEQALLEDIAAGSNRHGDRLGAIGQQRTELE
ARIEEQEARFSHEKALVQQLMASRQDISQQAEISELQQQLEQAQQGDVLVQADVDTRMVANVIADWTGVP
LSSLMKNEQTELLSLENEIGKRVVGQDVSLNAIAQRLRAAKTGLTSENGPQGVFLLVGPSGVGKTETALA
LADVLYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHLMQLLDEQPEATEGDLHELLRPILRDHFQPALL
ARFQTVIYRPLVEAAMRTIVEMKLSQVSKRLHRHYGLTTQIDESLYDALTAACLLPDTGARNVDSLLNQQ
ILPVLSQQLLTHMAARQKPQSLCLSWSEEEGIGLEFDRTQGVHV
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2070926-2073580 Enterobacter asburiae LF7a chromosome, complete genome
ATGGAAAATCCAGCCATCCTGTTGCGACGTCTGAACCCTTACTGTGCTCGTGCGATGGAAGGGGCGGCTT
CGCTCTGCCAGACCCGTGCCCATGCGGAAATTTTGCCGGAGCACTGGCTGCTGAAGTTGCTCGAACAGGG
GGAAGGTGACCTGACGGTGCTGGCACGTCGCTACGAGTGGGATATGGACACGCTGTGGCAGGCGTTGCTC
GGCTGGCTGGATAATCAACCGCGTTCGGTACGCAGCCGCCCGCAACTGTCCGCAGATATTCAGAAACTGA
TGCAGGAAGCCTGGATGCAGGCCTCACTTGCCGGAGAGGAAAGTATCCGAAGCCAGCACCTGCTGATGGC
GCTGACGGAAAACCCACGACTTGCTCACTGCGACGGGCTGTGGCCACTGTTGACGCTCGGGATGAGTCAG
CTTTCCCGACTACGCCCGCTGCTGGATGCTCAGTCTGATGAACGCCCGGAGATGCAGTTTGAGGCTGAAC
TGGCCCAGGTTCACGGCAGTGAGGTGGAGTTTGTTGGCCGTCCGGTTGGTGCAGAGCTGAAAGAGGGCGA
ACTGAACCCGGCGCTACAGAACGCGCTGGATAAATTCACCCTCGATGTCACCGCCAAAGCGAAAGAGGGC
AAGATTGATCCTGTGTTCGGTCGTGATACCGAAATCCGCCAGATGGTGGATATTCTCTCGCGCCGTCGTA
AGAACAACCCAATCCTGGTCGGTGAGCCAGGCGTCGGTAAAACCGCGCTGGTCGAAGGCCTGGCGCTGCG
TATTGCCGAGGGCAATGTGCCTGAGTCCCTCAAACCGGTCATCCTGCGCACCCTTGATCTCGGCTTGTTG
CAGGCTGGCGCAGGGGTGAAAGGCGAGTTCGAGCAGCGCCTCAAAAACGTTATCGACGCGGTGCAGCAGT
CACCGGTGCCGATTCTGCTGTTTATCGACGAAGCCCACACCATTATTGGTGCAGGTAACCAGGCGGGCGG
CGCGGATGCGGCCAACCTGCTGAAACCAGCACTCGCCCGCGGCGAACTGCGCACCATTGCCGCGACCACC
TGGAGCGAGTACAAACAGTATTTCGAGCGCGATGCCGCGCTGGAACGTCGCTTCCAGATGGTGAAGGTGG
ACGAGCCGGATGATGACACTGCGTGCCTGATGCTGCGTGGCCTCAAATCCCGCTATGCCGAACACCACAA
CGTACACATCACTGACGATGCGGTGCGTGCGGCCGTTACGCTGTCCCGTCGTTACCTGACGGGACGCCAG
CTGCCTGACAAGGCCGTTGACCTGCTGGATACCGCGGCCGCACGTGTGCGTATGAGTCTCGATACGGTGC
CAGAACAAATTGTGCGCCTGAAAGCACAACTGACCGCACTGGCACTGGAAGAGCAGGCGTTACTCGAAGA
TATCGCCGCTGGCAGCAACCGCCATGGTGATCGCCTTGGGGCCATTGGGCAGCAGCGGACTGAACTGGAA
GCGCGTATCGAGGAGCAGGAAGCGCGTTTCAGCCACGAAAAGGCGCTGGTACAGCAGCTGATGGCCAGCC
GACAGGACATCAGCCAGCAGGCTGAGATTTCCGAGCTGCAGCAGCAACTCGAACAGGCACAACAGGGCGA
CGTGCTGGTTCAGGCGGATGTGGACACCCGTATGGTCGCGAATGTTATCGCCGACTGGACCGGCGTGCCG
CTGTCTTCGCTGATGAAAAACGAACAGACCGAACTGCTGAGCCTGGAAAACGAAATTGGCAAACGTGTGG
TCGGGCAGGATGTTTCCCTTAACGCTATTGCGCAGCGTCTTCGCGCGGCGAAAACCGGCCTCACTTCCGA
AAACGGGCCGCAGGGCGTGTTCCTGCTTGTCGGTCCGAGTGGTGTAGGTAAGACCGAAACCGCGCTGGCG
CTGGCGGACGTGCTGTACGGCGGTGAAAAATCGCTGATTACCATTAACCTGTCCGAGTACCAGGAGCCGC
ACACCGTGTCGCAGCTGAAAGGCTCGCCTCCGGGCTATGTCGGTTACGGCCAGGGCGGCATTCTCACCGA
GGCCGTGCGCAAGCGCCCGTACAGCGTGGTGCTGCTCGATGAAGTGGAAAAGGCGCACCGTGACGTAATG
AACCTGTTCTACCAGGTTTTCGACCGCGGCTTTATGCGCGACGGCGAAGGGCGCGAAATCGACTTTCGCA
ACACCGTTATCCTGATGACCTCCAACCTCGGCAGCGACCACCTGATGCAGCTGCTGGACGAACAGCCGGA
GGCTACCGAAGGCGATCTGCACGAACTGCTGCGCCCGATTTTACGCGACCACTTCCAGCCGGCACTGCTG
GCTCGTTTCCAGACCGTGATTTACCGCCCGCTGGTGGAAGCGGCTATGCGCACTATTGTCGAAATGAAGC
TGTCACAGGTCAGCAAACGCCTGCACCGTCACTACGGCCTGACCACGCAGATAGATGAAAGCCTGTATGA
CGCGCTAACCGCCGCCTGCCTGCTGCCGGATACCGGCGCACGCAACGTTGACAGTCTGCTTAATCAACAA
ATTCTGCCGGTGCTGAGCCAGCAGCTGCTGACCCATATGGCCGCCAGACAGAAACCACAGTCGCTTTGCC
TTAGCTGGAGTGAGGAAGAGGGTATCGGGCTGGAGTTTGACCGTACACAAGGAGTGCACGTATGA