SecReT6
Protein ID: 345299104
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1939
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2086894..2088495 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDG2S0U9
KEGG IDeas:Entas_1939
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-23, Aligned region: 67..127
Protein Sequence: 533 a.a.     [Download]
>gi|345299104|ref|YP_004828462.1| type VI secretion-associated protein [Enterobacter asburiae LF7a]
MSTLQNLVAACQADHAQLREQAQTRTDNWQPWLTPVSAASPTGEDPGYDDDFQRIREEVNKLSGIDTGLI
CTLAEKLLTTTAKDIRIATYYCWARLHQDGEAGFAEGLELLAGLLQRYGMQLHPQRDRSRKAALEWLAGT
RVLDSLSLFPEVVREGAQRTTGALLLINTSLETEPEASRPELNTLYSGLESRLMKAGGVDAVVPQNAGNK
VQSQASTHTAESDTPVLSRITSGQDLLAQARILTGFLREQPDGWLAAHRLMKSLRHDTLRVIPAPDAEGK
TRIEPPRADQRAMLKRLYLQQSWLEILEQADSTFSRGANHLWLDLQWYIHQALVKLGQDVLADIIIADLK
GLLRRLTGLETLAFNDGTPFADEITLNWINQSVLDDMPCWRDEPVSAISTGDNDILALEPEALEKADSEG
LDATLHWLQTRPGTDSTKEKWLLRLLMARVAEQKGKNELALHLLGELDSAAQSITLTQWTPALLFEVKSR
RLRLLRMKATRSETDKSRLQPEMDQLLAGLIALDPASSAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2086894-2088495 Enterobacter asburiae LF7a chromosome, complete genome
ATGAGCACACTGCAGAATTTGGTTGCCGCCTGTCAGGCTGACCATGCTCAGCTTCGGGAACAGGCGCAGA
CGCGCACGGATAACTGGCAGCCCTGGCTTACTCCGGTAAGCGCTGCCAGTCCGACCGGGGAAGACCCGGG
ATATGACGATGATTTTCAGCGCATCCGCGAAGAGGTCAATAAGCTCTCCGGCATTGATACCGGACTGATC
TGTACGCTTGCCGAAAAACTGCTGACAACCACGGCCAAAGACATCCGGATTGCTACCTACTACTGCTGGG
CGCGCCTCCACCAGGATGGCGAAGCCGGCTTTGCCGAAGGACTTGAACTGCTGGCGGGATTACTGCAGCG
CTACGGCATGCAGCTTCACCCGCAGCGGGACCGCAGCCGCAAGGCTGCGCTGGAATGGCTCGCCGGTACC
CGTGTTCTGGACAGTCTGTCACTGTTCCCGGAGGTCGTACGAGAGGGTGCACAGCGTACCACCGGGGCCT
TACTGCTCATCAATACCAGTCTGGAGACAGAGCCGGAAGCATCGCGGCCAGAGCTGAATACCCTGTACAG
CGGGCTGGAGTCTCGCCTGATGAAGGCCGGTGGTGTGGATGCCGTAGTACCGCAGAACGCAGGTAATAAG
GTGCAGTCACAGGCCTCCACGCATACGGCCGAGTCAGATACGCCGGTTCTGAGCCGCATTACCTCCGGTC
AGGATTTGCTGGCCCAGGCCCGTATTCTGACGGGATTTCTGCGTGAGCAGCCCGATGGCTGGCTTGCTGC
ACACCGGCTGATGAAAAGCCTGCGTCATGACACGCTGAGAGTGATCCCTGCACCGGATGCCGAAGGGAAA
ACGCGTATCGAACCACCGCGGGCTGACCAGCGGGCCATGCTCAAACGGTTGTATCTGCAGCAGAGCTGGC
TGGAGATACTGGAGCAAGCGGACAGCACTTTCTCGCGTGGCGCTAATCACCTCTGGCTGGATTTGCAGTG
GTATATCCACCAGGCGCTGGTGAAACTGGGGCAAGATGTGCTGGCCGACATCATCATCGCCGACCTGAAA
GGGCTGCTGCGACGCCTCACCGGGCTTGAAACGCTGGCCTTTAATGACGGAACGCCGTTTGCCGATGAGA
TCACGCTCAACTGGATAAATCAGAGCGTGCTGGACGATATGCCCTGTTGGCGGGATGAACCAGTTAGTGC
TATCAGCACGGGTGACAACGATATTCTGGCGCTTGAACCTGAAGCGCTGGAGAAAGCAGACAGCGAAGGT
CTGGATGCCACACTCCACTGGCTGCAGACGCGTCCGGGCACCGACTCCACAAAAGAAAAATGGCTGCTGC
GTTTGCTGATGGCCCGCGTGGCCGAGCAGAAGGGTAAAAATGAACTGGCGCTGCATTTGCTGGGTGAGCT
CGATAGTGCCGCGCAGTCAATCACCCTCACGCAGTGGACACCGGCGCTGTTATTTGAAGTGAAATCCCGT
CGCCTTAGACTACTGCGTATGAAAGCAACACGCAGCGAAACCGATAAATCACGCCTTCAGCCGGAGATGG
ACCAGCTTCTGGCCGGTCTGATTGCGCTCGACCCGGCAAGCAGTGCGGTGCTGTGCGGGTAA