SecReT6
Protein ID: 345299106
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1941
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2090257..2091342 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDG2S0V1
KEGG IDeas:Entas_1941
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-77, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|345299106|ref|YP_004828464.1| type VI secretion protein [Enterobacter asburiae LF7a]
MGREAQSPYSRLTPRLEADLNRINFYRFCQLLEKLNPDRPLMGSTSHPGDDPVRFAPHPGMGFPASELKA
VEYDEEDDGKPPVVRTTFMGMYGVDSPLPTAYLDDISQRREGHEALQSFLDIFSHRILTQFYRIWRKYSY
PATFEPGGTDSISQSLLGLVGLGIPGTANHIATPVSRFLSLLGVLQQPGKTQEGMQALVSLLAPETTVRV
SPYCLRPVEVSRPLGFYGDDEFLLDGNTPLGDEAMDANSQLLIALFTDNEQESQGWKPDSLLYQDFLVML
RVYLGWRFKAKITLTARTRLLAAPPLGDGPFWLGMNGVLGAEDEDLPEDIPQTFTTELGYYAGLEPATPQ
QGNRRVTYKFN
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2090257-2091342 Enterobacter asburiae LF7a chromosome, complete genome
ATGGGAAGAGAAGCACAATCGCCGTATTCCCGGCTGACCCCGCGGCTGGAAGCTGATCTTAACCGTATAA
ATTTTTACCGTTTCTGCCAACTGCTGGAGAAACTGAATCCGGACCGGCCGCTGATGGGCTCAACTAGCCA
TCCTGGTGACGACCCGGTGCGCTTTGCGCCGCACCCCGGGATGGGCTTTCCAGCGAGCGAGCTGAAAGCG
GTGGAATATGACGAAGAGGATGACGGCAAGCCGCCGGTAGTACGCACCACCTTTATGGGGATGTACGGTG
TGGATTCGCCGCTGCCGACCGCCTATCTCGACGACATCTCCCAGCGCCGGGAAGGGCACGAGGCGTTGCA
GAGTTTCCTCGATATCTTCAGCCACCGCATCCTGACGCAGTTTTACCGCATCTGGCGTAAATACTCTTAT
CCGGCTACGTTTGAACCCGGCGGCACCGATAGCATTTCACAGTCGCTGCTTGGCCTGGTGGGGCTGGGTA
TTCCCGGTACGGCAAACCACATTGCCACCCCGGTGTCGCGCTTTCTGTCGCTGCTGGGTGTGCTACAGCA
GCCCGGGAAAACCCAGGAGGGGATGCAGGCCCTGGTGAGTCTGCTGGCCCCAGAGACCACCGTCAGGGTC
AGTCCTTACTGTCTGCGTCCGGTGGAGGTCAGTCGACCCCTGGGTTTTTACGGTGACGATGAATTCCTCC
TGGACGGCAATACGCCACTGGGTGACGAAGCAATGGATGCCAACAGCCAGTTGCTGATTGCCCTGTTCAC
CGATAACGAGCAAGAATCACAGGGCTGGAAACCGGATAGCCTGCTTTATCAGGACTTTCTGGTGATGCTA
CGGGTCTACCTCGGTTGGCGATTCAAGGCCAAAATCACCCTGACCGCCCGAACCCGCCTGCTGGCCGCTC
CGCCGCTTGGCGACGGCCCTTTCTGGCTCGGCATGAATGGTGTGCTGGGCGCAGAAGACGAAGACCTCCC
CGAGGATATTCCACAGACCTTTACCACCGAATTGGGTTACTACGCCGGGCTGGAGCCTGCGACACCACAA
CAAGGAAACCGACGTGTTACGTACAAGTTTAACTAA