SecReT6
Protein ID: 345299107
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1942
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2091320..2091865 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDG2S0V2
KEGG IDeas:Entas_1942
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-35, Aligned region: 19..172
Protein Sequence: 181 a.a.     [Download]
>gi|345299107|ref|YP_004828465.1| type VI secretion lipoprotein [Enterobacter asburiae LF7a]
MLRTSLTKTARWLLPLLAFSLVGCGVTQGITDGTKSAFNAVFYKKIKVLHLDFTAREALNTDSRENHSLS
EPVMIRIYQLKDRKTFDKTVYPQLLKDGETILKADLLASRDVVVKPGGDANLNMPMEADTQFVAVVGLFR
HPDMVNNTWKLVIGREDLDPDTPRILEAGNNHLTLQPLKDD
 
Nucleotide Sequence: 546 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2091320-2091865 Enterobacter asburiae LF7a chromosome, complete genome
GTGTTACGTACAAGTTTAACTAAAACAGCGCGCTGGCTGTTACCCCTGCTGGCATTCAGCCTGGTGGGGT
GCGGGGTGACGCAGGGCATCACCGATGGCACTAAATCGGCATTTAACGCCGTGTTCTACAAAAAGATTAA
GGTGCTGCACCTGGACTTCACGGCGCGTGAAGCGCTAAACACCGATTCCCGCGAGAATCATTCACTGTCC
GAGCCGGTAATGATTCGAATCTACCAGCTGAAAGACCGCAAAACCTTCGACAAAACGGTCTACCCGCAGT
TGCTGAAAGATGGGGAGACCATTCTGAAAGCTGACCTGCTGGCGAGCCGTGATGTGGTGGTGAAGCCGGG
TGGTGATGCGAACCTGAATATGCCGATGGAGGCCGATACACAGTTTGTGGCAGTGGTGGGGCTGTTCCGT
CACCCGGATATGGTCAACAACACCTGGAAGCTGGTGATAGGGCGCGAAGACCTTGACCCGGATACGCCGC
GCATTCTGGAAGCCGGTAACAATCATCTGACGCTGCAACCGCTCAAGGACGACTGA