SecReT6
Protein ID: 345299110
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1945
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2092908..2094293 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDG2S0V5
KEGG IDeas:Entas_1945
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.70E-51, Aligned region: 109..152
DUF3702 [PF12486], Evalue: 1.70E-51, Aligned region: 293..305
DUF3702 [PF12486], Evalue: 1.70E-51, Aligned region: 312..457
ImpA-rel_N [PF06812], Evalue: 6.20E-21, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 6.20E-21, Aligned region: 362..383
Protein Sequence: 461 a.a.     [Download]
>gi|345299110|ref|YP_004828468.1| ImpA domain-containing protein [Enterobacter asburiae LF7a]
MNDIIPRKIKTGGDPRTLPDYDALRDELSKLAHPARPDVNWQSVEKRCLSLFEQNGVELQTAAWYTLART
QLAGLVGLNEGLAILEALISHQWGVLWPQPVHARMEILSSLSQRLQQRMRSLPLNYNDLSQLYRAEQLLT
GLGEVLQRLELKHLSQLDTLRTLMHNSAVRLENLDDVTRSGATIQSGNVLPATEIHGVGISSGARASSTP
DDTPGNAMKWVYVAQQEQQTNVDVLTALPAPVKKWKSFVAGMGTMLVIGPLAVWGWLFLHRPDPLETQLA
ASLTPLPATLTPEQLDVLRQQSPLSQTVITQTQQQLARLEKLPPDWNITYSRKLTEQALMLWPEQAKPLV
QQWQQQLHASALPTEQLNGWYQGMTTLQKLSDRLNGLDEQKGKYMTVSELKSVVFSIRQSFNQSIPAEEQ
LRVLSGNPAGDPLSAAAQSQLEMHLKQLAARYAEIKQKASE
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2092908-2094293 Enterobacter asburiae LF7a chromosome, complete genome
ATGAATGACATTATTCCACGTAAAATAAAAACCGGTGGCGATCCGCGCACGCTGCCGGATTATGACGCCC
TGCGTGATGAACTGAGTAAGCTGGCCCATCCGGCGCGTCCGGATGTGAACTGGCAGTCTGTCGAAAAACG
CTGTCTTTCACTGTTTGAGCAGAACGGGGTGGAGCTACAGACAGCGGCCTGGTATACGCTGGCGCGGACG
CAGCTGGCCGGCTTAGTCGGGCTCAATGAAGGGCTGGCGATACTCGAGGCTCTGATTAGCCATCAGTGGG
GCGTACTTTGGCCGCAGCCCGTCCATGCCCGCATGGAAATCCTCAGCAGTCTGAGTCAGCGCCTGCAGCA
ACGGATGCGCTCGCTTCCGCTCAATTACAACGACCTTAGCCAGTTGTACCGGGCAGAACAGTTACTTACG
GGGCTGGGAGAGGTGCTGCAGCGCCTGGAGCTTAAGCATCTCAGTCAGCTCGATACGTTGCGTACTTTGA
TGCACAACAGTGCTGTCAGATTGGAAAACCTCGATGACGTAACCCGCTCCGGGGCGACCATTCAGTCGGG
TAACGTGTTGCCTGCTACCGAAATACATGGTGTCGGGATCTCGTCAGGCGCCCGCGCCAGTAGTACGCCT
GACGATACGCCAGGCAACGCCATGAAGTGGGTGTACGTTGCGCAGCAGGAACAGCAAACGAACGTGGACG
TGCTGACGGCACTGCCCGCGCCGGTAAAAAAGTGGAAATCCTTTGTTGCCGGCATGGGTACCATGCTGGT
GATCGGCCCCCTTGCCGTGTGGGGCTGGCTGTTTCTTCACCGGCCTGATCCGTTAGAAACTCAGCTTGCC
GCATCTCTGACACCGTTACCTGCGACACTCACCCCTGAACAGCTGGATGTGTTGCGTCAGCAGTCGCCAT
TATCACAAACCGTAATTACACAAACCCAGCAGCAGCTTGCCCGACTGGAGAAATTGCCGCCTGACTGGAA
TATTACTTACAGCCGAAAACTAACAGAACAGGCACTGATGCTGTGGCCGGAACAGGCTAAGCCCCTGGTT
CAACAGTGGCAGCAACAACTTCATGCTTCCGCACTACCCACAGAACAACTCAATGGCTGGTATCAGGGGA
TGACAACGTTACAAAAACTGAGTGACCGCCTGAACGGACTTGATGAGCAGAAGGGCAAATACATGACGGT
CAGCGAACTGAAGTCCGTTGTATTTTCCATCCGACAGTCTTTTAACCAGTCCATTCCGGCGGAAGAGCAA
CTGCGTGTATTGTCAGGAAACCCCGCTGGAGACCCTTTATCTGCCGCAGCGCAGTCTCAACTGGAGATGC
ATCTGAAACAACTGGCAGCCCGCTATGCTGAAATAAAACAGAAGGCATCAGAGTGA