SecReT6
Protein ID: 345300976
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3839
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4125324..4125842 [-]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDG2SCP4
KEGG IDeas:Entas_3839
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|345300976|ref|YP_004830334.1| Hcp1 family type VI secretion system effector [Enterobacter asburiae LF7a]
MPTPCYISIQGKTQGNITSGAFTSDSVGNIYVQGHEDQMLVQEFEHIVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPKVEMKWYRTSIEGKQEHFFSTILDDATIVDIDCKMPHCQDLQKAEFTQ
LVKVSLAYRKITWEHTVSGTSGADDWRAPIEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4125842-4125324 Enterobacter asburiae LF7a chromosome, complete genome
ATGCCAACTCCATGTTATATCTCAATCCAGGGTAAGACCCAGGGTAACATCACCTCCGGCGCGTTTACGT
CTGACTCTGTCGGTAACATCTATGTTCAGGGGCACGAGGATCAGATGCTGGTCCAGGAATTTGAACATAT
CGTTACGGTTCCGACCGATCCGCAGTCAGGCCAGCCATCAGGACAGCGTGCGCATAAACCGTTCAGATTC
ACTGTTGCACTGAACAAAGCGGTTCCTCTTCTTTATAACGCCCTGGCTTCCGGCGAGATGCTGCCTAAAG
TTGAAATGAAATGGTATCGCACGTCAATTGAAGGCAAACAGGAACACTTCTTCTCAACCATCCTGGATGA
TGCGACCATTGTGGATATCGACTGCAAGATGCCACACTGTCAGGATCTGCAGAAAGCGGAGTTTACACAG
CTGGTAAAAGTGTCTCTGGCCTACCGTAAGATTACCTGGGAACATACTGTATCAGGCACGTCTGGTGCAG
ATGACTGGCGTGCGCCAATCGAAGCCTAA