SecReT6
Protein ID: 345300981
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3844
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4131733..4132011 [-]
ProductPaaR repeat-containing protein
NotePAAR
UniProt IDG2SCP9
KEGG IDeas:Entas_3844
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-26, Aligned region: 1..49
PAAR_motif [PF05488], Evalue: 1.30E-26, Aligned region: 19..85
Protein Sequence: 92 a.a.     [Download]
>gi|345300981|ref|YP_004830339.1| PaaR repeat-containing protein [Enterobacter asburiae LF7a]
MGIPVSLKGHQHICPLDKHIGGPIQDGDPTLTVNGIAVALVGHRCECQKESPDVITGGTPLLTVNGIPVA
LVGSPTAHGGKVIEGDATLTIG
 
Nucleotide Sequence: 279 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4132011-4131733 Enterobacter asburiae LF7a chromosome, complete genome
ATGGGAATTCCAGTTTCATTAAAAGGACATCAGCATATCTGCCCGCTGGATAAACACATCGGCGGTCCGA
TACAAGATGGTGACCCCACACTGACAGTTAATGGTATTGCGGTGGCGCTGGTAGGGCACCGCTGTGAATG
CCAGAAAGAAAGTCCGGATGTCATCACCGGCGGGACGCCATTGCTGACCGTAAACGGTATTCCAGTCGCG
CTGGTAGGGTCGCCGACGGCGCACGGCGGCAAGGTGATTGAAGGTGATGCAACGCTCACGATTGGATAA