SecReT6
Protein ID: 345300982
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3845
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4132022..4134079 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG2SCQ0
KEGG IDeas:Entas_3845
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-67, Aligned region: 29..328
Phage_base_V [PF04717], Evalue: 1.10E-23, Aligned region: 367..459
Protein Sequence: 685 a.a.     [Download]
>gi|345300982|ref|YP_004830340.1| ImpA family type VI secretion-associated protein [Enterobacter asburiae LF7a]
MADSTGLQYTFVANSLSASTLSVVAFELKEGLSEPYELSLELATQHDDIAFPRVLDDSAELQIWYNGELT
RRVHGLVTRFARNDTGHQRTRYSVTLRPDLWLLSLEYHSRIFQQQTPQQIITQLLQKTGISAFHFSLRHD
HPVREYCVQYRESTLDFISRLAAEEGISWYFRFTGNAHEVVFIDDYTFLPKGEALPWNSHKRGLNEGASV
QRFSYEENLRVSQVLLKEYTFKNPAWAMLYREQGNKAPYRHHQMQHYDYPGRYKTDFNGDAYSGYRLDAL
RRDAMQAHGVSDSPSLTAGDCFSLTSHPHDDFNRVWQIVSLHTTGQQSQSQEEEAGVKGTWLESHFTVIP
DKLTWRPQPNPRPRVDGPQIATVVGPEGEEVWCDEVGRVRVQFPWDLEGENNENSSCWIRVAQGWAGSRY
GAMAIPRIGHEVIVSFLEGDPDQPIITGRTYHVVNVPPHSLPVHKTRTVLRTDTHKGAGYNELSFEDEND
NQLIYFHAEKDFQTKVKNNEYLVVEQDRFATIHHDQREEVKNDKTSIVEHDHIERVHHDQMINVIHNQQI
QVDNQYLFHVLNQRKDTMGADYTEETAGDHHHSVAGWYEMQAGKKVTVTTRELQLIGSEKVVIQGPNGKI
VMDSSGISISSSQLKINAMTKITASASSALNSLDVAAMNGDPLSEICPICKQSLS
 
Nucleotide Sequence: 2058 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4134079-4132022 Enterobacter asburiae LF7a chromosome, complete genome
ATGGCGGACAGTACCGGCCTTCAGTACACCTTTGTCGCGAATTCCTTATCTGCAAGCACATTAAGCGTCG
TTGCGTTTGAGCTAAAAGAGGGGCTGTCTGAACCCTATGAACTAAGCCTTGAGCTGGCAACTCAGCATGA
TGATATCGCTTTCCCTCGCGTACTGGATGATAGCGCTGAACTACAAATTTGGTATAACGGCGAGTTAACG
CGACGGGTTCACGGTTTAGTCACGCGATTTGCCCGCAACGATACCGGACATCAGCGCACGCGTTACAGCG
TGACACTCCGGCCTGACCTGTGGTTACTTTCTCTGGAGTACCACTCCCGTATTTTTCAGCAGCAAACACC
ACAGCAAATTATTACGCAATTGTTGCAAAAGACAGGGATCTCGGCATTTCATTTTTCTCTGCGTCACGAT
CATCCGGTACGCGAATACTGTGTTCAGTATCGTGAATCCACGCTGGATTTTATCTCTCGCCTCGCGGCCG
AAGAGGGGATCTCATGGTATTTCCGCTTTACGGGAAACGCCCATGAGGTGGTCTTTATCGATGACTACAC
CTTCTTACCAAAAGGGGAGGCATTGCCCTGGAATTCCCACAAACGAGGCCTTAATGAAGGTGCCAGCGTA
CAACGGTTTAGCTATGAGGAAAATTTACGCGTTTCTCAGGTACTGCTAAAGGAATACACCTTCAAAAACC
CTGCATGGGCAATGCTCTATCGTGAGCAGGGTAATAAAGCGCCGTATCGGCATCATCAGATGCAGCACTA
TGATTACCCCGGTCGCTATAAAACGGATTTTAACGGTGACGCTTACAGTGGCTATCGGCTGGATGCACTA
CGCCGAGATGCGATGCAGGCACACGGTGTTTCCGATTCCCCATCGTTGACGGCGGGTGATTGCTTCTCCC
TGACGTCTCATCCTCACGACGATTTTAACCGCGTCTGGCAAATTGTGTCCTTACATACCACGGGTCAACA
GTCGCAGTCCCAGGAGGAAGAGGCGGGGGTTAAGGGGACATGGCTTGAAAGTCATTTCACCGTGATCCCG
GATAAATTGACCTGGCGGCCACAACCCAATCCGCGTCCACGCGTTGATGGACCTCAAATCGCTACGGTTG
TGGGGCCAGAAGGCGAAGAAGTCTGGTGCGATGAAGTAGGGCGCGTGCGCGTCCAGTTCCCCTGGGATCT
GGAAGGCGAAAACAACGAAAACAGTTCCTGCTGGATCCGCGTGGCACAGGGATGGGCAGGGAGTCGTTAC
GGCGCAATGGCCATCCCGCGTATTGGTCATGAAGTGATTGTGTCGTTCCTGGAAGGCGACCCTGACCAGC
CGATCATCACCGGCAGAACATATCACGTCGTGAATGTCCCACCTCATTCCTTGCCAGTGCATAAAACCCG
TACCGTATTGCGTACTGACACGCATAAAGGGGCTGGCTATAACGAATTGTCATTTGAAGATGAAAATGAC
AATCAGCTGATCTATTTCCATGCGGAAAAAGATTTTCAGACCAAGGTCAAAAACAATGAGTACCTCGTTG
TTGAACAGGATCGTTTTGCCACTATCCACCATGACCAGCGGGAGGAGGTAAAAAACGATAAAACCTCCAT
CGTCGAACACGATCACATAGAGCGTGTTCATCACGACCAGATGATCAACGTCATCCATAACCAGCAAATT
CAGGTTGATAACCAATATCTCTTTCATGTGCTTAACCAGCGTAAAGACACGATGGGGGCCGATTACACCG
AAGAGACGGCGGGCGATCACCACCATAGTGTTGCGGGCTGGTACGAGATGCAGGCGGGGAAAAAAGTCAC
CGTCACCACCCGAGAATTACAGCTCATTGGCTCGGAAAAAGTCGTGATTCAGGGGCCAAACGGCAAGATT
GTCATGGACAGCAGCGGGATATCGATATCCAGCAGCCAGCTCAAAATCAACGCCATGACAAAAATTACTG
CCAGTGCCAGCAGTGCGCTCAACTCGCTTGATGTTGCCGCAATGAATGGCGATCCACTCTCGGAAATTTG
CCCAATCTGTAAACAATCATTGAGTTAA