SecReT6
Protein ID: 345300984
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3847
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4134482..4135876 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDG2SCQ2
KEGG IDeas:Entas_3847
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.20E-27, Aligned region: 306..446
ImpA-rel_N [PF06812], Evalue: 3.20E-16, Aligned region: 40..99
Protein Sequence: 464 a.a.     [Download]
>gi|345300984|ref|YP_004830342.1| ImpA domain-containing protein [Enterobacter asburiae LF7a]
MEHLDYQPVATGKDPRAFEAFEVIRAEINKLNHPLHPVIDWNLLQSQAIKLFSSNGVDLQSVVYYSMART
RLNQWSGFAEGCELLAVLIVSQWEIVWPPVNPGRARQEILDWFAARVGSAIRQLPKNKLSLRDIYRAEYA
LSKICEKLNAISNINFTLLQSVHFYLVQTINSIQPPDESTTNNNGPTVTLPLVYLPENKESNPPSAETAA
QSDRQQQVFTDTSSLNAFAGKRSKAKGRGRGILAGMVTGVLLTLLGTFVVSRFQQRSVVDEMLMSTQPPP
ALVKTATAENHLTELTASRPLILEKYQQKLETILAQSPVESMSAGLEMVSLLDDIYPGNTVTRGWYKQVE
QLSSQGNVPGYEQAKEKLQLLMDELLNNEKQHRTVTISYLKSAIYDIQQRLSETEPLSYQLTSIEQSIRK
GKQPSLADLQKVDDQLKGIQARYLQTLQTLKSAQTPLSYQDEKK
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4135876-4134482 Enterobacter asburiae LF7a chromosome, complete genome
ATGGAACATTTAGATTATCAACCTGTCGCAACGGGCAAAGACCCTCGTGCTTTCGAAGCATTTGAGGTTA
TTAGAGCAGAGATTAATAAATTAAATCATCCGCTTCATCCTGTTATTGACTGGAACCTCCTGCAATCTCA
GGCGATCAAGTTGTTTTCCTCTAATGGCGTTGACCTGCAGAGCGTCGTTTATTACAGCATGGCACGTACC
CGGTTAAATCAGTGGAGTGGTTTTGCTGAAGGGTGTGAATTATTGGCTGTGCTGATTGTTTCTCAGTGGG
AAATAGTTTGGCCACCGGTAAATCCGGGTAGGGCAAGGCAAGAAATCCTCGACTGGTTTGCCGCGCGAGT
CGGTTCGGCCATTCGGCAATTGCCTAAAAATAAGTTGTCGCTGCGTGATATCTATCGCGCTGAATATGCG
TTGAGTAAAATATGTGAAAAGTTGAATGCTATAAGCAACATAAATTTTACGCTCCTGCAAAGTGTCCATT
TTTATCTGGTACAGACGATTAATTCCATTCAGCCCCCGGATGAATCAACGACGAATAATAACGGACCTAC
CGTGACGTTACCGCTGGTCTATCTTCCAGAAAATAAAGAGAGCAATCCACCTTCGGCGGAGACAGCGGCG
CAGTCGGACAGACAACAACAGGTATTCACTGATACTTCTTCGCTTAATGCTTTCGCCGGAAAGCGATCCA
AAGCTAAAGGGCGAGGGAGGGGAATATTGGCTGGCATGGTGACCGGTGTGCTATTAACGCTGCTGGGAAC
GTTTGTGGTTAGCCGTTTTCAACAACGCAGCGTGGTTGACGAAATGCTCATGAGTACACAACCCCCTCCT
GCGTTGGTCAAGACGGCAACAGCGGAAAATCATCTCACGGAGCTCACGGCCAGCCGCCCGTTGATTCTTG
AAAAATACCAGCAAAAGCTGGAGACCATCCTTGCGCAGTCGCCAGTGGAATCAATGAGTGCAGGGCTTGA
GATGGTCAGTTTGCTGGATGACATTTATCCGGGAAATACCGTAACTCGTGGATGGTATAAGCAGGTTGAA
CAACTTTCTTCTCAGGGCAATGTGCCCGGCTATGAACAGGCAAAAGAGAAGCTTCAGTTGCTCATGGACG
AACTCCTCAATAACGAAAAGCAGCATCGCACCGTTACGATCTCTTACCTCAAAAGCGCCATTTACGACAT
TCAACAGCGTCTGTCGGAGACCGAACCGCTCTCTTACCAGTTAACGTCAATCGAGCAATCCATCCGTAAA
GGTAAACAGCCTTCCCTGGCCGATCTTCAGAAAGTGGACGATCAGCTGAAAGGGATCCAGGCCCGTTATC
TGCAAACGTTGCAGACGCTGAAGTCAGCCCAAACACCCCTCTCTTATCAGGATGAAAAGAAATGA