SecReT6
Protein ID: 345300988
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3851
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4143126..4145720 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG2SCQ6
KEGG IDeas:Entas_3851
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-36, Aligned region: 281..317
AAA_2 [PF07724], Evalue: 1.50E-36, Aligned region: 601..761
AAA [PF00004], Evalue: 2.10E-16, Aligned region: 24..58
AAA [PF00004], Evalue: 2.10E-16, Aligned region: 223..335
AAA [PF00004], Evalue: 2.10E-16, Aligned region: 607..714
AAA_5 [PF07728], Evalue: 4.70E-14, Aligned region: 223..243
AAA_5 [PF07728], Evalue: 4.70E-14, Aligned region: 606..724
ClpB_D2-small [PF10431], Evalue: 5.10E-13, Aligned region: 768..846
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 200..244
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 266..301
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 478..478
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 577..647
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 672..700
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 222..308
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 329..395
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 605..625
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 667..700
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 781..803
AAA_29 [PF13555], Evalue: 9.80E-05, Aligned region: 216..244
AAA_29 [PF13555], Evalue: 9.80E-05, Aligned region: 604..631
DUF258 [PF03193], Evalue: 0.00025, Aligned region: 198..240
DUF258 [PF03193], Evalue: 0.00025, Aligned region: 607..624
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 223..297
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 602..635
NACHT [PF05729], Evalue: 0.00087, Aligned region: 223..265
NACHT [PF05729], Evalue: 0.00087, Aligned region: 417..450
NACHT [PF05729], Evalue: 0.00087, Aligned region: 607..624
NACHT [PF05729], Evalue: 0.00087, Aligned region: 798..836
MobB [PF03205], Evalue: 0.0011, Aligned region: 223..266
MobB [PF03205], Evalue: 0.0011, Aligned region: 606..626
IstB_IS21 [PF01695], Evalue: 0.0018, Aligned region: 217..247
IstB_IS21 [PF01695], Evalue: 0.0018, Aligned region: 606..617
Protein Sequence: 864 a.a.     [Download]
>gi|345300988|ref|YP_004830346.1| type VI secretion ATPase, ClpV1 family [Enterobacter asburiae LF7a]
MIRIEIAALVERLHPLVRRALEQAAAASVNQHATEISVIHLLNELIDAPLCDIRFIFDEYGIDVGRAESL
LHVSPLDRTDYPQSYPSFSPLLIEWLQDSWLLASTELNHKELRSGALFLVLLTHRHRYLPVDFCRLIEGI
HREQLTARLNQITKDSAENSTTDSPLSVTTPVNVGGEGSLLSRFTTDITEAARENRLDPVLCRDEEIDLM
IDILCRRRKNNPIVVGEAGVGKSALIEGLAIRIVANQVPDQLKGTVVLSLDLGAMQAGASVKGEFEKRFK
GIMQEIFDAPMPVILFIDEAHTLIGAGNTQGGLDVSNLLKPALARGELKTIAATTWREYKKYIEKDAALT
RRFQLVKVNEPDLAQATTILRGLVARYEIAHNVLVDDEALVAAVQLSARYISGRQLPDKAIDVLDTACAR
CAINLTAPPREFTRLETRLKETEQEIHHIEREQRIGLNEYAERLGELFSLRQRLQTEREILEKQWDSQKT
LVSEIISLRQSLLKEEASSDTALQLADREAQLITLQKTQKCLSTHVDKDQISAVIAEWTGVPLQQITQNE
LKVITELPDFLSKTIKGQDLAIGHLHRHLLTARADLRRTGRPLGAFLLVGPSGVGKTETVLQLTELLFGG
NAWLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGILTEAIRKKPYSVVLLDEVEKAHPDVLNLFYQAFD
KGEMADGEGQLIDCKNIAFFLTSNLGYQTIVEMSDSPEQIPDALYPELAAFFKPALLARMETVPFLPLGS
EILVSIIRSKLAELSNKLSTRFNAEIIIDEAVYQEIFDRATRKENGARMLESVIDGALLPPVSMVILQKL
SHGDTISRIHFGIEANNFTVEVES
 
Nucleotide Sequence: 2595 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4145720-4143126 Enterobacter asburiae LF7a chromosome, complete genome
ATGATTAGGATTGAAATAGCCGCTCTTGTAGAACGGTTGCATCCTCTCGTTCGTCGTGCTCTTGAACAGG
CCGCGGCGGCGAGTGTTAATCAGCATGCAACTGAAATTAGTGTAATTCATTTATTAAATGAATTAATTGA
CGCTCCTCTTTGCGATATTCGGTTCATATTTGATGAATATGGTATCGATGTCGGGCGCGCAGAATCTTTA
TTACATGTTAGTCCTCTCGATCGTACTGACTATCCGCAGTCATACCCTTCATTTTCACCATTGCTTATCG
AATGGTTACAGGATAGCTGGTTACTGGCGTCGACGGAGCTGAATCATAAAGAGCTGCGTAGCGGAGCCTT
GTTTTTGGTTTTGCTGACACATCGTCATCGCTACCTTCCGGTTGATTTTTGCCGCCTAATCGAAGGAATA
CACCGTGAGCAGTTGACTGCCAGACTTAATCAAATCACAAAGGATTCCGCTGAGAATAGTACTACTGATT
CTCCCTTATCCGTAACTACTCCGGTCAATGTTGGTGGAGAGGGCTCGCTACTTTCTCGCTTTACTACCGA
TATAACCGAGGCTGCACGTGAGAACCGGCTCGACCCCGTTTTATGTCGGGATGAAGAGATAGACCTGATG
ATCGATATTCTTTGTCGTCGTCGCAAAAACAATCCCATTGTTGTCGGTGAAGCTGGCGTGGGGAAAAGTG
CGCTGATTGAAGGATTGGCTATTCGCATCGTTGCGAACCAGGTACCAGACCAGCTTAAAGGAACGGTAGT
GCTTTCGTTGGATCTGGGGGCGATGCAAGCGGGAGCCTCAGTTAAAGGAGAGTTTGAGAAGAGATTCAAA
GGGATCATGCAGGAAATCTTTGATGCGCCAATGCCAGTCATTTTGTTTATTGATGAAGCGCATACTCTGA
TAGGTGCGGGCAATACGCAGGGAGGGCTGGATGTTTCAAACTTACTCAAGCCCGCGCTGGCCAGAGGGGA
GTTAAAAACAATCGCTGCCACGACCTGGCGGGAGTACAAAAAATACATTGAGAAAGACGCGGCATTAACC
CGACGCTTCCAGCTTGTAAAAGTCAACGAACCTGATCTCGCTCAGGCAACAACCATTCTCCGGGGGTTGG
TGGCTCGTTATGAAATCGCGCATAACGTTCTTGTTGATGACGAGGCGCTGGTCGCTGCAGTTCAATTAAG
TGCTCGTTATATTTCAGGCCGACAACTTCCTGATAAAGCTATCGATGTTCTTGATACCGCCTGTGCGCGC
TGCGCCATTAACCTGACGGCTCCACCCCGAGAGTTCACCCGGCTTGAAACCCGATTGAAAGAAACGGAAC
AAGAAATTCATCATATTGAACGTGAGCAGCGCATAGGACTAAACGAATATGCGGAACGCCTGGGTGAGCT
TTTTTCATTGCGTCAACGTCTCCAGACCGAACGGGAAATCCTTGAAAAGCAGTGGGATAGCCAGAAGACA
CTGGTTTCAGAAATAATCTCCTTGCGCCAGTCTCTCCTTAAAGAAGAAGCATCTTCCGATACCGCATTGC
AATTAGCGGATCGTGAAGCGCAGCTGATTACGTTACAAAAAACGCAGAAGTGCCTTTCAACACATGTCGA
CAAAGATCAGATTTCGGCGGTCATCGCTGAATGGACGGGCGTACCTCTACAGCAGATCACGCAAAATGAG
CTGAAAGTTATCACAGAACTTCCTGATTTCCTTTCTAAAACCATTAAAGGTCAGGATCTTGCCATTGGGC
ATCTTCATCGACATTTATTAACCGCGCGTGCAGATTTAAGGCGAACCGGACGTCCCCTGGGCGCTTTTTT
GCTGGTGGGGCCAAGCGGTGTCGGTAAAACAGAAACCGTGTTACAACTCACCGAACTCCTTTTTGGGGGG
AATGCCTGGTTAACGACCATCAATATGTCGGAATTTCAGGAGAAGCACACTGTTTCAAGGCTTATTGGCT
CTCCTCCTGGCTACGTTGGGTACGGCGAAGGCGGGATCCTGACAGAGGCTATACGTAAAAAGCCCTATTC
GGTTGTGCTGCTGGATGAAGTCGAAAAAGCGCATCCAGACGTGCTGAATTTATTCTATCAAGCCTTTGAT
AAAGGGGAGATGGCGGATGGCGAAGGGCAGCTTATTGATTGCAAGAATATCGCCTTTTTCCTGACATCAA
ATCTGGGTTACCAGACCATCGTTGAAATGAGTGATAGTCCGGAGCAGATACCTGATGCGCTCTATCCAGA
ACTGGCTGCATTCTTCAAACCGGCCTTACTTGCACGTATGGAAACTGTACCTTTCCTCCCGTTAGGCAGT
GAGATATTGGTGTCCATTATTCGCAGCAAGCTTGCTGAGTTGTCGAATAAATTATCCACACGATTTAACG
CGGAAATTATTATTGACGAGGCGGTATATCAGGAGATTTTTGACCGGGCAACCCGCAAAGAAAATGGCGC
TCGAATGCTGGAGTCTGTAATAGACGGAGCACTACTGCCGCCTGTTTCCATGGTGATTTTACAAAAACTT
TCCCACGGCGATACTATCAGCCGTATACATTTTGGCATTGAGGCGAATAATTTCACCGTTGAGGTCGAAA
GCTAA