SecReT6
Protein ID: 345300990
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3853
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4146558..4147898 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDG2SCQ8
KEGG IDeas:Entas_3853
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.40E-147, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|345300990|ref|YP_004830348.1| type VI secretion protein [Enterobacter asburiae LF7a]
MLTRNRIVWGEGLFIKPQHFQQQQRHNDYLLYASLSALTEHFYGVSELKINEDHLGFGRITLVTASGIMP
DGTFFSLPYEDVLPLPLQVSEANLVGQVVYLAVPLASDHILEINTSLEHNGSRTRYQACLESVRDLYSQS
AEIAAVNVAKVNLRLMLESDDRSTFASLPVARIADKRPDGSLLLDPHFIPTCLTINTVTHLKSFLSEVTG
LVGERAKNLADRIGSPGQQGVADVAEFMLLQLLNRTQPVLEHLNSRAVVHPEHLFTLLSGFCGELMTFTD
LSRLPRSIPRYFHDDLQRSFQPLMLALRQALSTVLSPRAQSLQLIEQRFGVFVAAVTQEELLRDADFVLA
VKANMPLDILSKQFVQQSKIATPEAIMKLVSTHTHGIPLRPLATSPRQLPYHNGYIYFSLDRQSPYWPRV
GTNTGFAFHIGGKFPELDMQFWAIRR
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4147898-4146558 Enterobacter asburiae LF7a chromosome, complete genome
ATGTTAACCCGCAACCGAATTGTCTGGGGGGAAGGGTTATTTATTAAACCCCAACATTTTCAGCAGCAGC
AAAGGCATAATGATTATCTGCTTTATGCTTCGCTTTCAGCTTTAACTGAGCATTTTTACGGTGTATCTGA
GTTAAAAATTAACGAAGATCACTTAGGCTTTGGTCGCATCACGCTTGTTACTGCTTCAGGCATCATGCCC
GATGGGACATTCTTTAGCTTACCTTATGAAGATGTGCTTCCCCTTCCGTTGCAAGTCTCAGAGGCTAATC
TGGTTGGGCAAGTCGTTTATCTCGCGGTGCCTTTGGCGAGCGATCATATCCTTGAGATAAATACTTCTCT
GGAGCATAACGGAAGCCGGACGCGTTATCAGGCGTGTCTTGAGTCTGTCCGCGATCTTTATTCTCAGAGT
GCAGAAATAGCGGCAGTAAATGTCGCAAAAGTTAACCTGCGGCTGATGCTGGAAAGTGATGACAGAAGCA
CGTTTGCGTCGCTCCCTGTTGCGCGAATTGCGGATAAGAGACCTGACGGGAGCTTGCTGCTGGATCCGCA
TTTTATCCCCACCTGCTTAACCATTAATACCGTCACGCATTTGAAAAGCTTCTTGTCTGAAGTCACCGGT
CTGGTTGGTGAGCGAGCAAAAAATCTGGCGGACAGGATTGGATCTCCGGGTCAGCAGGGCGTCGCTGATG
TTGCTGAATTTATGCTGCTGCAGCTTTTAAATCGCACACAACCCGTTCTTGAACATTTAAACAGCCGAGC
GGTTGTGCACCCCGAACATCTGTTCACTCTGTTATCCGGGTTTTGCGGTGAATTAATGACGTTTACCGAT
CTTAGCCGATTGCCCAGGAGCATCCCGCGCTATTTCCATGATGATTTGCAGCGTAGTTTCCAGCCATTAA
TGCTGGCACTTCGACAGGCGCTGAGCACCGTTCTTTCACCTCGGGCACAGTCTTTGCAGTTAATTGAGCA
ACGCTTTGGCGTCTTTGTTGCTGCGGTTACGCAAGAAGAGCTGCTCCGGGATGCAGATTTTGTCCTTGCA
GTGAAAGCGAACATGCCTCTTGATATTTTGAGTAAGCAATTTGTTCAGCAAAGTAAAATCGCAACACCTG
AAGCGATTATGAAACTGGTCAGCACGCATACGCATGGTATCCCTCTGCGTCCGCTTGCCACCTCGCCTCG
TCAGTTGCCATACCATAATGGCTATATCTATTTCTCTTTAGATCGCCAGAGCCCTTACTGGCCGAGAGTG
GGGACAAATACCGGGTTTGCTTTTCACATCGGCGGGAAGTTCCCAGAGCTAGATATGCAATTCTGGGCTA
TCAGGAGATAA