SecReT6
Protein ID: 345300992
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3855
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4148413..4149669 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDG2SCR0
KEGG IDeas:Entas_3855
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.30E-07, Aligned region: 34..103
Protein Sequence: 418 a.a.     [Download]
>gi|345300992|ref|YP_004830350.1| FHA domain-containing protein [Enterobacter asburiae LF7a]
MNDSMELILTVVDLNSVGRKIDRSHRFSKEGGTIGSLDAGETRHWQVQDSRQEIQSIHARIIWQDGQFCL
EDVSGTTFVNEAGHSIGAQNVIALSAGDQIKMGSITFTTQIIIGSEKVDIADYQHPQSLITMSNQSDVNQ
IIDEPSVTGTHSGYPQSVVYSHRPYDPGTLGMGGSLSSSEFIPSEDNILDTSAAISRAEPMLDEEFIDIP
TPASSLYGESHESQPFESVAITPLMRGMGHFLSLSDSQQANGFLEEAGRTLEAAIKGILLLEQDRIRVNK
QLQPVEDNPLRLGLDYVATVDALFGDQQSQVHLSPSAAITECLSFLRMHAYASRQAVSEALTCVVDTFSP
DVLMARFQRYRRDHLVDINDPTWIWEMYNHYFEELKSTRQQGVDRLFHEVFEQVYDKALRDLRDEDKS
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4149669-4148413 Enterobacter asburiae LF7a chromosome, complete genome
ATGAATGATTCAATGGAACTGATTCTAACCGTTGTGGATTTGAACAGTGTCGGCAGAAAAATCGATCGTT
CTCATCGTTTTAGTAAAGAGGGCGGAACGATTGGAAGTTTGGATGCTGGCGAAACCCGGCACTGGCAGGT
ACAGGATAGCCGTCAGGAGATCCAAAGTATTCATGCCAGAATTATCTGGCAAGATGGTCAATTCTGTCTT
GAAGATGTCAGTGGAACAACTTTTGTCAACGAAGCCGGGCACAGTATTGGCGCGCAAAATGTGATTGCGC
TGTCCGCTGGGGACCAGATCAAAATGGGGAGCATTACATTCACGACCCAGATAATCATCGGTAGTGAAAA
AGTGGATATTGCTGATTATCAACATCCCCAGAGCCTTATTACTATGTCGAACCAGAGCGATGTAAACCAA
ATCATTGATGAACCTTCAGTGACTGGTACGCATTCAGGCTACCCGCAATCTGTTGTTTACAGTCATCGCC
CTTATGATCCGGGCACTCTGGGTATGGGAGGTTCGCTTTCATCCTCAGAATTTATACCTTCAGAAGATAA
TATCCTCGACACCTCGGCCGCTATTTCACGGGCAGAGCCCATGCTGGATGAAGAATTTATTGATATCCCC
ACGCCAGCATCGTCTCTTTACGGCGAGAGTCACGAATCACAGCCCTTTGAAAGTGTAGCAATTACGCCGT
TGATGCGCGGAATGGGACATTTTTTAAGTCTTTCGGATAGCCAGCAGGCCAATGGCTTTTTAGAAGAAGC
CGGACGCACGCTGGAAGCTGCTATCAAAGGGATTCTGCTTCTGGAGCAGGATCGCATCCGTGTTAATAAG
CAGCTTCAGCCCGTAGAAGATAACCCGCTGCGGTTAGGCTTAGATTATGTCGCCACGGTTGATGCGCTTT
TCGGGGACCAACAGAGCCAGGTTCATTTGTCGCCATCTGCTGCGATAACGGAATGCCTCTCTTTTTTGAG
AATGCATGCGTATGCCTCTCGTCAGGCAGTGAGCGAAGCCCTCACGTGTGTGGTTGACACCTTCTCCCCA
GACGTCCTTATGGCGCGTTTTCAGCGCTACCGTCGCGATCACCTGGTTGATATAAACGATCCGACATGGA
TTTGGGAAATGTATAACCACTATTTTGAAGAGCTAAAATCGACAAGGCAGCAGGGGGTCGACCGCCTGTT
TCATGAAGTTTTCGAACAAGTCTACGATAAAGCTCTGCGTGATTTACGCGATGAGGACAAGTCATGA