SecReT6
Protein ID: 345300993
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3856
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4149675..4150631 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDG2SCR1
KEGG IDeas:Entas_3856
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.70E-85, Aligned region: 4..304
Protein Sequence: 318 a.a.     [Download]
>gi|345300993|ref|YP_004830351.1| type VI secretion protein [Enterobacter asburiae LF7a]
MNNNLKDYNFYQLVELLYRSEGQDIEQLENQLPENERIRYFASASLGFPSGDIVSVNKQDHGYDIEVSFL
GLHGAQSPLPGYYLENLAWQYMHQENGPGQFLNFFNHRFLMLLHRGWRKYRYHVRYRPGGVDRFSQCMFA
LIGLGSEVLRDSVAINHSKMLAYAGLLAAPGRSPQVVEGLMSHCFDLDDVKILCWQYRRVAIAKHQQNRL
GQANMSIGNDFVVGEYAPNISSKYILKINQLSYSTFLRFLPNGDLFAPLTKVMSFIMREQFAWDLELNLA
HNQSENTCLGRGKGCLLGWTTFLAPLPKNLKVSLCVQE
 
Nucleotide Sequence: 957 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4150631-4149675 Enterobacter asburiae LF7a chromosome, complete genome
ATGAATAATAATTTAAAAGATTATAATTTTTACCAGCTTGTTGAGTTGCTCTACCGTAGTGAAGGGCAGG
ATATCGAACAGCTTGAGAATCAGTTACCCGAAAATGAGCGGATTCGGTACTTCGCTAGTGCTTCACTTGG
TTTTCCTTCAGGCGATATAGTATCCGTTAATAAGCAAGATCATGGTTATGATATAGAGGTATCCTTCCTC
GGACTGCATGGAGCTCAGTCGCCGCTACCTGGATATTACCTGGAAAACCTTGCATGGCAGTATATGCATC
AAGAAAATGGGCCGGGGCAATTTTTGAATTTCTTTAACCATCGTTTTTTGATGCTGTTACATCGTGGATG
GCGGAAATATCGTTACCATGTTCGATATCGCCCTGGCGGTGTAGACCGATTTTCTCAATGTATGTTTGCC
CTGATAGGGCTGGGAAGTGAAGTGCTACGCGATTCGGTGGCAATAAATCACAGCAAAATGTTAGCTTATG
CAGGCCTCCTTGCTGCTCCCGGCCGTTCGCCTCAGGTTGTTGAGGGACTAATGTCTCATTGCTTTGATTT
GGATGACGTTAAAATTTTATGCTGGCAATATCGCCGGGTAGCGATAGCAAAGCATCAACAAAATCGACTC
GGGCAAGCCAATATGTCGATTGGCAATGATTTTGTTGTTGGAGAATACGCTCCAAATATTAGCAGTAAAT
ACATATTAAAAATTAATCAATTAAGCTATTCCACCTTTTTACGTTTTCTCCCTAACGGCGATCTTTTTGC
ACCGCTGACAAAAGTGATGTCTTTTATAATGAGGGAACAGTTTGCGTGGGATTTAGAGTTAAATTTAGCA
CACAACCAGTCTGAAAATACATGTCTCGGTCGTGGAAAGGGATGTCTACTCGGTTGGACGACCTTTCTTG
CTCCTTTGCCAAAAAATTTAAAAGTTTCACTCTGTGTTCAGGAATAA