SecReT6
Protein ID: 345300994
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3857
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4150631..4152409 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDG2SCR2
KEGG IDeas:Entas_3857
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-177, Aligned region: 3..592
Protein Sequence: 592 a.a.     [Download]
>gi|345300994|ref|YP_004830352.1| type VI secretion protein [Enterobacter asburiae LF7a]
MKLEEFFRDELSWLRKQGADFSRTSPQLTRFLAEKSADPDVERLLEGFAFLSGTLRAKIEDDFPELTHGL
LNILWPNYLRPVPSFTIIECQPKMGSITEACLVKKGIKLGSKEIKGTGCTFSTCRDIRILPVELTNIVTI
NTNENGCLSLTLKPFSAMPLDKIRLDNLRLFLGSDYYVASQLYLYMLNHIKNVTVKLDGTEFTLPEAKAS
PVGFSDNDALLPYPKNVYSGYRILQEFFCFPEGFLFVDIHGFDQLPQNIAVSDIELSFHYDKPFPSDCRI
TSSSIKLNCSPAANLFEHHAEPIQLHGKRMSYPLRASHMLPEHYEVFSVENVEGWKSEHAGKDGERIKGE
LRTYHAFESFRHEVEFEKKRTMNYFKVSICNSMKMKGYEHNISFLRSDESILRSSDEIVAVTMLCTNRNL
PAELGIGDIRLPLGDSPPWLAYSNVLLPSQTLRPMIDEKLHWTLISSMALNYHSLLDKDALLQIIRNYDF
PAMNDRHAAKISQKRFEGVEKIETKPVDRLIRGMPVRGIHSTLYAKQSAFMSEGEFYLFGCILARFLSLF
SNINSFHELSLIDTENNSTYHWPLQQGNHSLI
 
Nucleotide Sequence: 1779 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4152409-4150631 Enterobacter asburiae LF7a chromosome, complete genome
ATGAAACTAGAAGAGTTTTTTAGGGATGAATTATCCTGGTTACGAAAGCAGGGGGCCGATTTCTCCAGAA
CCAGCCCTCAGCTCACCCGTTTCCTTGCGGAAAAGAGTGCAGATCCTGACGTTGAGAGACTTCTGGAAGG
TTTTGCATTCTTATCAGGTACATTGCGCGCAAAAATTGAGGATGATTTTCCGGAGCTCACCCATGGTTTA
CTAAATATTTTATGGCCTAATTATTTACGGCCCGTTCCATCATTTACTATCATTGAGTGCCAGCCCAAAA
TGGGATCTATTACCGAGGCTTGCCTCGTTAAAAAAGGGATTAAGCTGGGCTCCAAAGAAATAAAGGGGAC
TGGATGTACATTCTCTACCTGCAGGGATATTCGGATTTTACCTGTAGAACTCACCAATATTGTAACGATA
AACACAAATGAGAATGGATGTCTTTCGCTTACACTTAAGCCCTTTAGCGCGATGCCTCTCGATAAAATCA
GGCTGGATAACCTGAGATTGTTTCTCGGCAGTGACTACTATGTCGCTAGTCAACTATATCTTTACATGCT
AAATCATATTAAAAACGTCACGGTTAAGCTGGATGGTACCGAATTTACGCTGCCTGAAGCCAAAGCTAGC
CCTGTGGGTTTTTCTGACAATGATGCTTTACTACCATATCCTAAAAATGTTTACTCTGGCTACCGTATTT
TGCAGGAGTTTTTCTGTTTTCCTGAAGGGTTCCTGTTTGTCGACATTCATGGCTTTGACCAGCTTCCGCA
GAATATAGCGGTAAGCGATATTGAACTGAGTTTCCATTATGACAAACCTTTTCCCTCAGACTGTCGCATT
ACATCGTCATCAATAAAGTTGAATTGTTCCCCTGCGGCGAATCTATTTGAACATCATGCGGAGCCCATTC
AACTTCACGGAAAGCGAATGAGCTATCCGCTCAGGGCAAGCCATATGCTCCCCGAGCATTATGAAGTGTT
TTCCGTTGAGAACGTTGAAGGATGGAAAAGTGAACATGCAGGAAAGGACGGTGAACGCATCAAGGGAGAA
CTCAGGACGTATCATGCCTTTGAAAGCTTCAGGCATGAGGTTGAGTTTGAAAAAAAGAGAACGATGAATT
ATTTCAAAGTTAGCATTTGTAACTCAATGAAAATGAAGGGCTATGAGCATAATATTTCATTTTTGCGCAG
TGACGAAAGCATTCTGAGGAGTAGTGATGAAATCGTTGCGGTCACGATGCTCTGCACAAACCGGAACTTA
CCCGCGGAACTTGGAATCGGCGATATCCGTCTCCCTTTGGGAGACTCACCCCCCTGGCTTGCTTACAGCA
ATGTCTTATTACCTTCGCAGACATTGCGTCCTATGATTGATGAAAAATTGCACTGGACACTCATCTCCAG
CATGGCACTAAATTACCATTCACTTCTGGATAAGGATGCGTTGTTACAGATAATTCGAAATTATGATTTC
CCGGCAATGAACGACCGGCATGCGGCAAAAATTTCTCAGAAGAGATTTGAAGGTGTGGAAAAAATAGAAA
CAAAACCTGTCGACAGATTGATTCGAGGTATGCCTGTCCGGGGGATCCATTCAACATTGTACGCAAAACA
AAGTGCTTTCATGAGTGAGGGTGAGTTTTACTTATTTGGATGTATCCTGGCACGGTTTTTATCACTTTTT
TCTAATATTAACTCATTTCATGAACTGTCATTAATAGATACTGAAAATAATTCCACTTACCACTGGCCAT
TACAACAAGGTAATCATTCATTGATATAA