SecReT6
Protein ID: 345300995
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3858
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4152425..4152853 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG2SCR3
KEGG IDeas:Entas_3858
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-19, Aligned region: 31..122
Protein Sequence: 142 a.a.     [Download]
>gi|345300995|ref|YP_004830353.1| type VI secretion system lysozyme-like protein [Enterobacter asburiae LF7a]
MSALTAWRRSRSASLFERIEECNAARSADDTDDLVASLKRNLQAILNTRSGNAQSCPELGIIDFNDATGS
SVEVYSAMCRAIKRCIEDYEPRISRAEIIAQPNEADPLTLYFLVKAYVSLEERESIINFNLRIDGNHKYK
FE
 
Nucleotide Sequence: 429 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4152853-4152425 Enterobacter asburiae LF7a chromosome, complete genome
GTGTCTGCGCTTACTGCATGGCGAAGGAGTCGTTCTGCCAGCCTTTTTGAGCGCATTGAGGAGTGCAATG
CCGCCAGGTCTGCGGATGACACTGACGATCTGGTGGCTTCTCTAAAACGCAATCTTCAGGCGATACTCAA
CACCCGCTCTGGTAACGCGCAGAGTTGTCCCGAATTAGGCATTATCGATTTCAATGATGCAACGGGGAGC
TCTGTTGAGGTTTATTCGGCGATGTGTAGGGCAATTAAACGATGCATAGAGGATTATGAGCCGAGAATAA
GCAGGGCTGAAATCATCGCGCAACCTAATGAAGCCGATCCTTTAACACTTTATTTTTTGGTTAAAGCATA
CGTTTCGCTCGAGGAGCGTGAGAGCATTATCAATTTCAATTTGCGTATTGATGGAAATCACAAATATAAA
TTTGAGTGA