SecReT6
Protein ID: 345300996
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3859
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4152858..4154336 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDG2SCR4
KEGG IDeas:Entas_3859
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.30E-188, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|345300996|ref|YP_004830354.1| EvpB family type VI secretion protein [Enterobacter asburiae LF7a]
MIVESVNQNGELINEASSLLDHIMHQARLQPEDEGYDIAKHGISAFIANLLESGQEDVPVNKLIVDRMIA
ELDKKMSAQMDEILHSDEFQNMESSWRSLKLLVDRTDFRENIKITILHATKEELLDDFEYSPEIVQSGFY
KHIYASGYGQFGGEPVAAVIGNYAFTPSAPDMKLLQYVSSVGAMAHAPFISSAAPAFFGLKSFTELPAIK
ELKAVFEGPAYVKWRALRESEDSRYLGLTTPRFLLRLPYDSEDNPAKSFDYRETIQGEHDNYLWGNTAYL
MACNLTDSFARYRWCPNIIGPQSGGAVHDLPVHKFESLGQLQAKIPTEVLITDRREFELAEEGFITLTMR
KGSDNAAFFSANSVQKCKVFPNTREGKIAETNYRLGTQLPYMFIINRLAHYVKVLQREQLGAWKERQDLE
RELNRWIRQYVADQENPPAEVRSRRPLRAAQITVSDVEGDPGWYQVSMAVRPHFKYMGASFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4154336-4152858 Enterobacter asburiae LF7a chromosome, complete genome
ATGATAGTTGAAAGTGTTAATCAAAACGGTGAATTAATAAATGAGGCATCCTCATTACTTGATCACATAA
TGCATCAGGCCAGACTTCAACCTGAGGATGAAGGATATGATATTGCTAAGCATGGCATATCAGCATTTAT
AGCGAATTTACTGGAGTCAGGGCAAGAAGATGTTCCAGTAAATAAGTTAATCGTTGATAGAATGATCGCC
GAACTCGACAAAAAAATGAGTGCTCAGATGGATGAGATTCTGCATTCTGACGAGTTCCAGAATATGGAAT
CCTCCTGGCGGTCATTAAAACTTCTGGTGGACAGAACGGATTTTAGAGAAAACATCAAAATTACGATCCT
TCATGCCACAAAAGAAGAGTTGTTAGACGATTTTGAATATTCCCCTGAAATTGTACAATCTGGATTCTAT
AAACATATCTACGCGAGTGGTTATGGCCAGTTTGGCGGAGAGCCGGTAGCCGCTGTCATTGGTAACTATG
CGTTCACACCCTCTGCCCCGGATATGAAGCTCCTCCAGTATGTCAGCTCCGTTGGCGCTATGGCACATGC
GCCATTTATCTCTTCGGCCGCACCAGCCTTCTTTGGCCTCAAAAGCTTTACTGAACTTCCTGCCATTAAG
GAGTTAAAAGCTGTTTTCGAAGGTCCAGCATACGTCAAGTGGCGTGCCTTAAGAGAATCAGAAGATTCAC
GTTATTTAGGACTTACGACACCGCGTTTCTTGTTGCGTCTTCCTTACGACAGTGAAGATAATCCGGCTAA
ATCCTTTGATTATCGTGAAACCATTCAGGGTGAACATGATAATTACCTGTGGGGAAACACGGCCTATCTG
ATGGCCTGTAATCTGACGGATAGCTTCGCCCGTTATCGCTGGTGCCCAAATATCATTGGACCTCAAAGTG
GTGGTGCTGTGCATGACTTACCAGTGCATAAGTTTGAGTCCCTTGGGCAACTTCAGGCCAAAATCCCAAC
CGAGGTCCTGATAACCGACCGTCGTGAGTTTGAACTCGCTGAAGAGGGATTTATCACGCTTACAATGCGC
AAAGGCAGCGATAATGCAGCTTTCTTCTCGGCAAACTCAGTACAGAAATGCAAAGTATTCCCCAATACTC
GGGAAGGAAAAATCGCAGAAACTAATTACCGACTTGGCACTCAACTTCCTTACATGTTCATCATTAACCG
CCTGGCTCACTATGTAAAAGTCCTCCAGCGGGAACAGCTTGGTGCGTGGAAAGAGCGCCAGGATCTGGAG
CGAGAACTTAACCGCTGGATTAGGCAATATGTTGCAGACCAGGAAAACCCGCCGGCAGAAGTACGTAGCC
GCCGTCCTTTACGCGCAGCTCAAATCACCGTTTCTGATGTAGAAGGCGATCCTGGCTGGTATCAGGTGTC
CATGGCTGTGCGGCCACATTTTAAATATATGGGGGCGAGTTTCGAACTCTCTCTCGTTGGTCGTTTGGAC
AAGGAATAA