SecReT6
Protein ID: 345300997
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3860
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4154366..4154884 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDG2SCR5
KEGG IDeas:Entas_3860
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-56, Aligned region: 9..161
Protein Sequence: 172 a.a.     [Download]
>gi|345300997|ref|YP_004830355.1| type VI secretion protein [Enterobacter asburiae LF7a]
MSKKIYEGSIAPKERINIKYVPATGDEQAEVELPLNILVVGDLKGGKEDSAIEEREGISINKHNFDSVMQ
TAGLRLNFSVKNKLQDNTDEELPISLNINALKEFSPDNVARQVPELKRLLELREALVALKGPLGNIPSFR
ASLQQLLTDGEMRAQLLKELDIALEDDSAIKE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4154884-4154366 Enterobacter asburiae LF7a chromosome, complete genome
ATGAGTAAAAAAATATACGAAGGAAGCATAGCACCCAAAGAACGTATAAATATTAAGTATGTTCCAGCAA
CAGGGGATGAACAAGCTGAAGTCGAATTACCCCTTAACATTTTAGTTGTGGGCGACCTAAAAGGTGGCAA
AGAAGACTCCGCTATTGAAGAAAGAGAGGGTATCTCAATTAATAAGCATAACTTTGATTCGGTTATGCAA
ACTGCTGGCCTACGACTGAACTTCTCAGTGAAAAATAAGTTACAAGACAATACTGATGAAGAGTTGCCGA
TCAGTTTGAACATTAATGCACTCAAAGAGTTTTCACCCGATAACGTTGCACGACAAGTTCCTGAATTGAA
AAGATTACTTGAGCTAAGAGAGGCTCTGGTCGCGTTGAAGGGCCCATTGGGCAATATTCCTTCGTTCAGG
GCAAGTTTACAGCAGTTACTCACAGATGGCGAAATGCGTGCACAACTTCTCAAAGAACTTGATATCGCTC
TTGAAGACGATAGCGCCATAAAAGAGTAA