SecReT6
Protein ID: 345301721
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4614
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]122043..124577 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG2SDD8
KEGG IDeas:Entas_4614
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.90E-43, Aligned region: 212..315
AAA_2 [PF07724], Evalue: 3.90E-43, Aligned region: 575..739
AAA [PF00004], Evalue: 1.50E-18, Aligned region: 212..344
AAA [PF00004], Evalue: 1.50E-18, Aligned region: 580..698
AAA_5 [PF07728], Evalue: 4.00E-14, Aligned region: 212..232
AAA_5 [PF07728], Evalue: 4.00E-14, Aligned region: 286..342
AAA_5 [PF07728], Evalue: 4.00E-14, Aligned region: 579..700
ClpB_D2-small [PF10431], Evalue: 4.30E-11, Aligned region: 745..827
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 190..232
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 256..290
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 425..484
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 572..616
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 645..672
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 211..318
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 577..600
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 640..673
AAA_25 [PF13481], Evalue: 1.50E-06, Aligned region: 212..288
AAA_25 [PF13481], Evalue: 1.50E-06, Aligned region: 566..597
AAA_14 [PF13173], Evalue: 2.80E-06, Aligned region: 212..322
AAA_14 [PF13173], Evalue: 2.80E-06, Aligned region: 578..662
AAA_18 [PF13238], Evalue: 4.10E-06, Aligned region: 212..234
AAA_18 [PF13238], Evalue: 4.10E-06, Aligned region: 581..609
AAA_19 [PF13245], Evalue: 7.40E-06, Aligned region: 101..134
AAA_19 [PF13245], Evalue: 7.40E-06, Aligned region: 212..233
AAA_19 [PF13245], Evalue: 7.40E-06, Aligned region: 576..607
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 212..239
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 500..513
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 580..604
AAA_17 [PF13207], Evalue: 2.20E-05, Aligned region: 212..251
AAA_17 [PF13207], Evalue: 2.20E-05, Aligned region: 579..617
Sigma54_activat [PF00158], Evalue: 6.90E-05, Aligned region: 207..224
Sigma54_activat [PF00158], Evalue: 6.90E-05, Aligned region: 577..693
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 212..232
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 573..619
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 194..231
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 579..597
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 192..226
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 265..343
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 576..592
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 650..661
Clp_N [PF02861], Evalue: 0.00036, Aligned region: 26..75
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 204..228
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 575..590
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 211..229
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 282..292
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 546..599
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 647..673
Protein Sequence: 844 a.a.     [Download]
>gi|345301721|ref|YP_004821669.1| type VI secretion ATPase, ClpV1 family [Enterobacter asburiae LF7a]
MNNYLKRIVEKFTPESRICLDAAISQAISRSHYEIEVEHLLFTLITHNSELMESLSLGAGLAPDTLLRTV
QQMLDSFRNGNTNSPVFSSRLVQWLEKSWLHASAGWGQTLLAPHALIACLIDEEAVPGLVSSVRLALKCN
HKNAEKLLSSACFIPSDDISRITETPVTSLDKYTRNLSLLAREGKLDPVKGRETEIRQMIDILLRRRQNN
PILTGEPGVGKTALLEGLALRIAAGTVPDMIKPMEVLTLDLGLLQAGASVKGEFENRVQLLLKEISSAPQ
PVVLFIDEAHMLIGAGGPPGQQDVANLLKPALARGELRVVAATTWAEYKKYIEKDAALTRRFQVVKVEEP
GIDIATAMLRAVVPSMSNHHGVTILESAVHAAVELSNRYIAGRQLPDKCISLLDTACARVAVSQSHKPKE
IEHADSLLTNLVEERTALAKEGGHEHRLASLAQRENELNVTLEQLVALWEQQKLLVQRLRLSDNANDILR
WRQELSALHQSQAFVFECVDATCIADVVSSWTGVPLGRMVEKEYHQLKELLSRLETRVIGQSHALATVAT
QIRVSRANLSDPSKPTGVFMLAGPSGVGKTETAIILAELLYGGEQSLVTINMSEYQEAHSISGLKGTPPG
YVGYGQGGILTEAVKRNPYSVVLLDEVEKAHPDVMELFYQVFDKGVIEDSEGQLINFRNTLIIMTSNLAS
AQIVTSCASGESSPDALCELIRPEFERVFRPALMGRVKLIPYLPLEPKVLSQIIKLKLDNICKRYLSASE
NMVSLIYSDSVVAWISKKCQINQSGARDIDQMLIQHILPLLADKLLLEDKTTVKTIRISINRDKVTVRRL
NENE
 
Nucleotide Sequence: 2535 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c124577-122043 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAATAACTATTTAAAAAGAATTGTCGAGAAGTTCACACCCGAAAGCAGAATTTGTCTTGATGCAGCAA
TCAGCCAGGCTATTTCTCGCTCACACTATGAAATAGAGGTAGAACATCTTTTATTTACTCTTATTACCCA
TAATAGTGAACTAATGGAGTCTTTAAGTCTAGGGGCAGGCCTGGCCCCGGATACTCTTTTGCGGACTGTT
CAGCAAATGTTGGATTCGTTCCGTAACGGTAACACCAATTCTCCTGTGTTCTCATCAAGACTGGTGCAAT
GGCTTGAAAAGTCTTGGTTACATGCAAGTGCTGGCTGGGGACAAACACTTCTGGCCCCACATGCGCTCAT
TGCTTGTTTGATTGATGAAGAAGCGGTTCCGGGTCTAGTGAGTAGCGTACGACTGGCGCTGAAATGCAAT
CACAAGAATGCTGAGAAGCTGCTTAGTTCCGCGTGTTTTATTCCTTCAGATGATATTTCCCGAATTACTG
AAACACCCGTTACATCCCTAGATAAGTATACTCGAAACCTGAGTTTGCTTGCGCGTGAAGGCAAGCTTGA
TCCTGTTAAGGGCCGTGAGACAGAAATTCGACAAATGATCGATATACTGCTTCGCCGTCGCCAGAATAAC
CCGATTCTTACTGGTGAACCTGGCGTAGGGAAAACGGCCCTCCTTGAGGGGCTAGCTCTTAGAATTGCTG
CCGGCACTGTGCCGGATATGATTAAACCCATGGAAGTACTGACACTTGATCTCGGATTATTGCAAGCTGG
GGCAAGCGTTAAAGGTGAGTTTGAAAATCGCGTTCAGTTGTTATTAAAAGAAATCTCAAGTGCCCCTCAA
CCTGTTGTCTTATTTATTGATGAGGCACATATGTTGATCGGTGCCGGAGGACCGCCTGGCCAACAAGATG
TGGCTAACTTGTTAAAACCGGCTCTGGCTCGTGGAGAGTTACGTGTGGTTGCAGCCACTACGTGGGCGGA
ATATAAAAAGTATATTGAAAAAGATGCTGCTCTTACACGACGTTTCCAGGTTGTAAAGGTTGAAGAACCC
GGTATCGATATCGCTACGGCTATGTTACGGGCTGTCGTCCCCTCAATGTCTAATCATCACGGGGTTACTA
TTCTAGAAAGTGCTGTACACGCAGCAGTTGAATTATCTAATCGCTATATCGCCGGAAGACAGTTACCTGA
TAAGTGCATTAGCCTTCTTGATACGGCATGTGCTCGTGTGGCAGTCTCCCAATCGCATAAACCGAAGGAA
ATTGAACACGCAGATTCCTTGTTGACTAACCTTGTGGAAGAACGTACGGCGCTGGCTAAAGAAGGGGGGC
ATGAGCACCGGCTGGCAAGTCTGGCGCAGCGTGAAAATGAACTTAATGTCACCCTTGAGCAACTCGTGGC
ATTATGGGAACAACAAAAGCTACTTGTACAACGTTTGCGGCTAAGTGACAACGCTAATGACATTCTCAGA
TGGAGACAGGAACTTTCTGCACTTCATCAGTCGCAGGCATTTGTTTTTGAATGTGTTGATGCAACCTGTA
TTGCAGATGTTGTTTCAAGTTGGACTGGTGTTCCCCTCGGTCGAATGGTCGAAAAAGAATATCACCAGTT
GAAAGAGCTTCTCTCACGTCTTGAGACACGTGTTATTGGCCAGTCTCATGCTCTTGCTACTGTTGCTACA
CAAATACGAGTCAGCCGGGCCAATCTCAGTGACCCTTCAAAGCCAACAGGTGTTTTTATGCTGGCGGGCC
CCTCGGGAGTTGGGAAAACCGAAACGGCTATTATCCTAGCGGAACTGTTGTACGGCGGTGAGCAAAGCCT
GGTTACTATTAATATGTCTGAGTATCAGGAAGCTCACAGCATATCCGGTTTGAAAGGAACGCCACCTGGA
TATGTAGGGTATGGCCAAGGCGGTATATTGACTGAAGCTGTAAAGCGAAATCCGTACAGCGTAGTACTCC
TTGATGAAGTTGAAAAAGCTCATCCGGATGTAATGGAGTTGTTCTATCAGGTCTTTGATAAGGGAGTAAT
TGAGGATTCGGAAGGGCAGCTTATAAATTTCCGCAATACACTTATTATAATGACCTCTAATCTGGCGAGT
GCCCAGATTGTTACCTCATGTGCATCAGGTGAATCATCCCCTGATGCATTGTGCGAATTAATACGCCCTG
AATTCGAACGTGTTTTTCGACCGGCGCTTATGGGGCGGGTTAAGCTTATACCTTATTTACCTCTGGAGCC
TAAAGTACTGTCTCAAATAATCAAGCTTAAGCTTGATAATATATGTAAAAGATATCTTTCTGCCAGTGAA
AATATGGTGAGTCTAATCTATAGCGATAGTGTGGTTGCTTGGATTTCTAAGAAATGTCAGATAAACCAAA
GCGGCGCCAGAGATATCGACCAAATGCTCATTCAGCATATCCTTCCGTTACTAGCCGACAAGTTACTGCT
AGAGGATAAAACTACAGTGAAAACGATAAGAATTAGTATCAATAGAGATAAGGTGACTGTGAGGAGGTTA
AATGAAAATGAATAA