SecReT6
Protein ID: 345301723
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4616
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]128040..128648 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDG2SDE0
KEGG IDeas:Entas_4616
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.70E-28, Aligned region: 2..193
Protein Sequence: 202 a.a.     [Download]
>gi|345301723|ref|YP_004821671.1| DotU family type IV / VI secretion system protein [Enterobacter asburiae LF7a]
MELLNCYLPVFRLGACLNSKSENTEVYEDFRQKCVSCLEQAKKDAEECDVSEIERELALFAVVVWLDEIV
LCSTKPIAQVWRIELLQRSYFQTSIGGELFFDRMSKLEEAHIEARRVFVFCLLNGFRGKYNSEPELDEVI
YYQRELCLPGEWQVWPNEASITPIEIQKRPFTTSTINYVGLAVLCIGLTYVTFLAFMFTYFY
 
Nucleotide Sequence: 609 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c128648-128040 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGGAACTTCTCAACTGCTACTTGCCTGTTTTCAGACTGGGTGCTTGTCTGAACTCGAAATCAGAAAATA
CTGAGGTTTATGAGGATTTTCGACAGAAGTGTGTTTCATGTCTAGAACAAGCTAAAAAGGATGCTGAAGA
GTGTGATGTATCGGAAATTGAGCGAGAGCTTGCACTGTTTGCTGTGGTGGTTTGGTTAGATGAAATCGTT
TTATGCTCAACTAAGCCTATTGCACAAGTATGGCGTATAGAATTGTTACAACGAAGCTATTTTCAGACAT
CAATTGGTGGTGAGCTATTTTTCGATCGAATGAGTAAGTTAGAAGAAGCCCATATCGAGGCAAGACGGGT
TTTTGTTTTTTGTCTTTTGAATGGTTTTCGAGGGAAATACAATTCGGAACCGGAATTAGACGAGGTAATA
TATTACCAACGTGAGTTATGTTTACCAGGAGAATGGCAAGTATGGCCGAATGAAGCTTCAATAACACCTA
TTGAAATACAGAAGAGACCTTTTACTACGTCAACTATAAACTACGTCGGATTGGCAGTACTGTGTATTGG
GCTGACTTACGTCACTTTTTTGGCGTTCATGTTTACTTATTTCTACTAA