SecReT6
Protein ID: 345301724
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4617
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]128651..130024 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDG2SDE1
KEGG IDeas:Entas_4617
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-73, Aligned region: 20..454
Protein Sequence: 457 a.a.     [Download]
>gi|345301724|ref|YP_004821672.1| type VI secretion protein [Enterobacter asburiae LF7a]
MHPEQQQVYWYSGLYLQPQHLQSLDLHHTYMLSQQRQVSQPWNVGILHCEINYDTLVDFSLNIDRLQLIL
PSGIYLEYPGNCIIESRQFRDIWRKREKPFTLWLVLRRFDPNHQNVSAGSNSRWISTVPDTEMKDIYHSG
PECAVSRIIYNVRILSDEEVESAVDSECIRFIRLRYDNDRVIYDPTFSPPAVTLSGTPSLRKILDGLYAE
LSSRARTLEEYKRPGLLSIGSRNPVDTNQLLVMRTLNRIVPLFGHYLRTPMIHPWQIYGILVQLIGELSS
FNDMCSFSGEWLDGGSPVLPYDHLSLFDSFNSVKQTLLSLLNGLALEDTVYIKLIRDNQGAYIGDLKTHE
FSNASTVLLLLQTNKPPVLSDNSSLNGEFKISTQEDLRTLVSHSLPGLSSHLITPSPRGVPNREDFYYFS
IDKNDPVWRSIEKNRNIAFYWAEAPDDLQVQLVFMES
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c130024-128651 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGCATCCTGAGCAACAGCAGGTGTACTGGTATTCCGGGTTGTATCTTCAACCACAACACCTACAATCCT
TGGATCTTCATCATACTTATATGTTATCTCAACAGCGGCAGGTATCTCAACCGTGGAATGTAGGGATATT
ACATTGCGAAATAAATTATGATACATTGGTCGATTTTTCTTTAAATATTGACAGATTACAGTTGATTTTA
CCATCAGGTATTTATCTTGAGTATCCCGGTAATTGTATAATTGAGTCTCGTCAATTTCGTGATATCTGGA
GAAAGCGTGAAAAGCCCTTTACACTATGGCTTGTTCTGCGCCGTTTTGATCCCAATCATCAGAATGTAAG
TGCTGGGTCAAATAGTCGCTGGATTAGTACAGTTCCTGATACTGAAATGAAAGATATATATCACTCAGGA
CCTGAGTGTGCTGTGTCGCGTATTATTTATAATGTTAGAATATTAAGTGATGAGGAAGTAGAGAGTGCAG
TAGACAGTGAATGTATACGATTTATTAGGCTTCGTTATGATAATGACCGTGTTATATATGACCCAACTTT
TAGTCCTCCTGCGGTTACACTTTCAGGCACTCCAAGCCTGAGAAAGATTCTTGATGGATTATATGCAGAA
CTTAGTAGCAGGGCTCGTACTTTGGAGGAATATAAACGTCCAGGATTGTTGAGTATCGGGAGCAGAAACC
CAGTTGATACAAACCAGTTGCTTGTGATGCGTACACTAAATCGTATCGTACCTCTGTTTGGGCATTACCT
CAGAACACCGATGATTCATCCATGGCAAATTTACGGAATCTTGGTGCAACTTATCGGTGAACTTTCTTCA
TTTAATGACATGTGTTCATTTTCCGGTGAATGGCTTGATGGCGGTTCCCCAGTGTTGCCTTACGACCACC
TATCTTTATTTGATTCCTTCAATAGTGTTAAGCAAACCTTGTTATCTTTGCTGAATGGACTTGCTCTTGA
GGATACTGTGTATATTAAACTTATTCGAGATAACCAAGGTGCATATATTGGGGATCTTAAAACGCATGAA
TTTTCTAATGCTAGTACTGTACTGCTTCTCCTTCAGACCAATAAACCCCCTGTTTTGTCAGATAATTCTT
CATTAAACGGGGAGTTTAAAATATCAACGCAGGAAGATCTGCGAACACTAGTTTCTCATTCCTTACCTGG
CCTTTCATCACACTTGATTACCCCCTCTCCAAGAGGAGTTCCAAATCGCGAGGATTTTTACTACTTTTCG
ATCGACAAGAATGATCCTGTCTGGAGAAGTATTGAAAAGAACCGGAATATTGCCTTCTATTGGGCTGAAG
CACCTGATGACTTACAAGTTCAACTTGTCTTTATGGAGTCATAA