SecReT6
Protein ID: 345301725
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4618
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]130014..130673 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG2SDE2
KEGG IDeas:Entas_4618
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.30E-19, Aligned region: 15..180
Protein Sequence: 219 a.a.     [Download]
>gi|345301725|ref|YP_004821673.1| hypothetical protein Entas_4618 [Enterobacter asburiae LF7a]
MNTTVIRLLFISSFMVLDGCSLDVAHTASTKQQAINEVKAPYMQAAITVNISATPELNALDDIANSCSLL
VIQAEKPSVLDKILNNPSQLKTLFSGSSEDEILKIDRYSVMPSQQTTLHIDRTENTRYIAIVAGYYPFPK
KQHMSIVRIPVTTSSKGLWTKSWYAEMAPLIINISLGSQSITNLTTSPSQSDSEQVKGSEEPMNLDTRTP
ETGVKENAS
 
Nucleotide Sequence: 660 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c130673-130014 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
GTGAATACTACAGTTATCCGCTTACTGTTTATCAGTTCCTTTATGGTTCTCGATGGTTGCTCGCTTGATG
TTGCACATACTGCGTCTACAAAGCAACAGGCTATAAATGAAGTGAAGGCACCTTATATGCAAGCTGCTAT
CACAGTAAATATCAGCGCAACTCCGGAGCTTAACGCATTAGATGATATAGCAAATAGTTGTTCTTTGCTT
GTTATTCAGGCGGAAAAACCTAGTGTACTAGACAAAATATTAAATAATCCATCACAGTTGAAAACTCTGT
TTAGTGGAAGTAGTGAAGATGAGATTCTAAAAATCGACCGATATTCCGTTATGCCAAGTCAGCAGACAAC
TTTGCACATCGACCGTACAGAGAACACGCGTTATATTGCAATCGTTGCTGGCTACTATCCTTTCCCTAAA
AAGCAACACATGTCTATTGTAAGGATTCCTGTGACCACATCGAGCAAAGGGTTGTGGACTAAATCGTGGT
ATGCAGAGATGGCACCTTTAATTATCAATATCAGCTTAGGAAGCCAGAGTATTACGAATTTAACTACTTC
TCCTTCACAATCAGATAGTGAACAAGTCAAAGGCAGTGAAGAACCAATGAACCTTGATACAAGAACACCT
GAGACAGGAGTTAAAGAAAATGCATCCTGA