SecReT6
Protein ID: 345301726
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4619
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]130670..131734 [-]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDG2SDE3
KEGG IDeas:Entas_4619
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 59..120
Protein Sequence: 354 a.a.     [Download]
>gi|345301726|ref|YP_004821674.1| ImpA family type VI secretion-associated protein [Enterobacter asburiae LF7a]
MKTMQQEIAVLLAPITPDVPAGKNIEYEQIYDDIRKARESDNDDVHQDMWGVADPRRADWHKVLRLCETA
LTQMSKDLQVSCWFVEALTHLKGLAGAEVGLNFLGEFISRFWFQCWPALDDEGAAFRNGKLNRLDRDLSL
TLSNFQLLQVPESSLSHWRKILAFEHKIAVNPKSRDDHIAMDGDLTMETFSRTASTFSSVELSLQAGILQ
GIYVNLNRLEECYFTLSQEEPQGLFLMTRKTIDDISDFLQNLAQRISPAVSETMTWSMAPESDIPSVSDR
GDFSNEIYSREKAISQMLSIAHFFRQTEPSSPVPFLIERAVRWTNMTLSEWLEEMLSDNNSLKEINNVLK
GQQQ
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c131734-130670 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAAAACAATGCAACAAGAAATAGCTGTGTTACTGGCTCCCATTACACCAGACGTACCCGCTGGTAAAA
ATATAGAGTACGAGCAAATTTATGATGATATTCGTAAAGCGCGCGAAAGCGATAATGATGATGTCCATCA
AGATATGTGGGGGGTTGCCGATCCGCGACGTGCTGACTGGCATAAAGTCCTAAGACTCTGCGAAACAGCC
TTAACCCAGATGAGTAAAGACCTGCAAGTTTCTTGCTGGTTTGTTGAGGCATTGACACACTTGAAAGGTC
TCGCAGGTGCTGAAGTGGGATTAAATTTTCTTGGGGAGTTTATTTCACGTTTCTGGTTCCAGTGTTGGCC
TGCTCTGGATGATGAAGGGGCTGCCTTTCGTAACGGGAAGCTTAATCGTCTCGACCGTGATCTCAGCCTG
ACACTGAGCAATTTTCAGCTCCTGCAAGTTCCTGAATCATCGCTATCCCACTGGCGAAAGATTTTAGCTT
TTGAACATAAAATTGCTGTAAATCCGAAGTCACGCGATGATCATATTGCAATGGACGGCGACTTAACGAT
GGAAACTTTTTCCCGTACAGCGTCCACATTTTCATCGGTTGAACTCAGCTTGCAAGCAGGTATTTTGCAA
GGTATCTATGTTAATTTAAACCGGTTGGAGGAATGTTATTTTACTCTTAGCCAGGAAGAGCCTCAGGGCC
TGTTCTTAATGACAAGAAAGACCATTGATGATATTTCTGATTTTCTACAAAACCTAGCTCAAAGAATATC
TCCTGCTGTATCTGAAACTATGACCTGGAGTATGGCTCCTGAGTCTGATATTCCTTCAGTAAGTGATAGA
GGTGATTTTAGTAACGAGATATATTCTCGAGAGAAAGCTATTAGTCAAATGCTTTCAATAGCACATTTTT
TCCGTCAGACAGAGCCCTCAAGTCCCGTACCATTTCTGATAGAACGTGCTGTACGTTGGACTAATATGAC
ATTGTCAGAATGGCTTGAGGAAATGTTAAGTGATAATAATAGTCTGAAAGAAATTAATAATGTTTTAAAA
GGACAGCAACAGTGA