SecReT6
Protein ID: 345301728
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4621
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]132207..134048 [-]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDG2SDE5
KEGG IDeas:Entas_4621
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-48, Aligned region: 34..320
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 368..459
Protein Sequence: 613 a.a.     [Download]
>gi|345301728|ref|YP_004821676.1| type VI secretion system Vgr family protein [Enterobacter asburiae LF7a]
MSLIPQLVGKQENHFLQWNGSLSSDWVLLSISGHESISAPYSFDAVSMTSLSDEEISKIHGQKVSCRIGD
SSDKKFSRNIHGVVTLIQSDKQTGLDGNSICILRIEPSFALLRMGLSMRVWKNITVPDLVKELLSENKIY
QLDIKLHNTYQKREYCIQYRESDFEFISRLMEEEGIYYYFVHESQQHRMVLADQPSSHPESRCSFIRWHN
QRISLPEGCVYNWKSMSNIIPGEVIFLGYNIQQAKIMIGDSSSKDEFSKINNIAYRDMLPVSERTLLIEK
AKARMEAFDTNTSFFTASTNAYWLSCGEYFNLTEHPEYNGMYRLQDISINATNSTGDDVGVFNADIKLLR
HNVNWRPVCTKYPPNISGVLTAKVVGPDGEDVHTDEFGRIKIQFQWDLKNAGEGKDSCWVRVSQPWSGNM
FGMQFIPRVGSEVLVSFIQGNPDYPLVTGTVYNGQNKPPFPLPVEKFESGLVSRSIKGVIGEGHRLSFND
KKGEEKLIISAQKDYILRVRNDATTYVEHEFNKTIGGGRTTTINNGDDTLELKNGKYLLSVNNGGVCIDA
GDKMEFKVGSNEITISSNGITIKGKTISIQGQDMVDIGGEISTVIKGKTINIG
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c134048-132207 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGTCTCTAATACCACAGCTAGTTGGAAAGCAGGAAAATCACTTTCTACAGTGGAATGGATCACTGTCAT
CTGACTGGGTTTTGCTGTCAATATCTGGTCATGAGTCCATCTCAGCTCCTTATTCTTTTGATGCCGTATC
GATGACTTCTCTAAGTGATGAAGAAATATCTAAAATTCATGGACAGAAAGTCTCATGTCGGATAGGTGAT
AGTTCGGATAAGAAGTTTAGTAGAAATATTCACGGAGTAGTGACACTCATTCAAAGTGATAAGCAAACGG
GCTTGGATGGTAACTCAATTTGCATACTTAGAATTGAGCCTTCCTTTGCACTATTACGAATGGGGCTTTC
GATGCGTGTATGGAAGAATATCACTGTTCCTGATTTAGTGAAAGAGTTACTTTCAGAGAATAAGATATAT
CAGCTAGATATCAAGCTTCATAATACATATCAGAAGCGGGAATATTGTATTCAATATCGTGAGTCAGATT
TTGAATTTATTAGTAGATTGATGGAAGAAGAAGGTATTTATTATTATTTTGTACATGAATCACAACAACA
TAGAATGGTTCTTGCAGATCAACCATCAAGTCATCCTGAGAGTCGTTGTTCATTTATCCGTTGGCATAAT
CAAAGAATTTCATTGCCAGAGGGTTGTGTCTATAACTGGAAGTCAATGTCTAATATAATCCCTGGCGAAG
TGATATTCCTAGGATATAATATTCAACAAGCTAAAATAATGATAGGAGATTCTAGTTCGAAAGATGAGTT
TAGCAAAATTAATAATATAGCCTATAGAGATATGTTGCCAGTTTCAGAACGGACATTACTTATAGAAAAA
GCTAAAGCGAGGATGGAAGCATTTGACACAAATACGAGCTTTTTCACAGCTAGTACTAATGCGTATTGGT
TGAGTTGCGGCGAGTATTTTAATCTGACTGAGCATCCTGAGTATAATGGTATGTATCGACTTCAGGATAT
TTCAATCAATGCTACCAACAGTACTGGTGATGATGTAGGTGTATTTAATGCTGATATTAAGTTGTTACGG
CATAATGTAAACTGGCGTCCTGTGTGTACTAAATATCCACCTAATATTTCAGGTGTTTTAACTGCAAAAG
TTGTCGGTCCTGATGGTGAAGATGTTCATACAGATGAGTTTGGAAGAATTAAAATACAATTTCAGTGGGA
TTTGAAAAATGCAGGAGAGGGTAAAGATTCTTGTTGGGTTCGTGTATCTCAACCCTGGAGCGGAAATATG
TTTGGAATGCAATTTATACCACGTGTAGGAAGTGAGGTTTTAGTAAGTTTCATTCAAGGAAATCCAGACT
ATCCACTTGTCACTGGTACTGTATATAATGGTCAGAATAAACCTCCTTTCCCTCTTCCAGTTGAAAAATT
CGAGTCTGGGTTAGTATCTCGTAGCATTAAGGGTGTTATTGGTGAGGGGCATCGTCTCAGTTTTAATGAT
AAAAAGGGGGAGGAGAAACTTATTATATCGGCACAAAAAGATTATATTTTGAGGGTTCGAAATGATGCTA
CAACCTATGTTGAACATGAATTTAATAAAACAATAGGTGGAGGCAGAACCACAACTATCAATAATGGTGA
CGACACTCTTGAACTTAAAAATGGAAAGTACTTGTTGAGCGTAAATAATGGTGGCGTCTGTATTGATGCA
GGGGATAAGATGGAGTTTAAAGTTGGTTCAAACGAAATCACTATTTCATCTAATGGTATTACTATAAAAG
GTAAGACTATAAGCATTCAAGGCCAGGATATGGTCGATATAGGTGGTGAAATCTCTACGGTTATAAAAGG
TAAAACTATTAATATTGGCTGA