SecReT6
Protein ID: 345301729
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4622
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]134051..135004 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDG2SDE6
KEGG IDeas:Entas_4622
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-54, Aligned region: 8..294
Protein Sequence: 317 a.a.     [Download]
>gi|345301729|ref|YP_004821677.1| type VI secretion protein [Enterobacter asburiae LF7a]
MDLITIVSKFNFYQQVRTLLHKLRTDELSGTEVLDKKIHFVSTLSLDSPDGQVAKIEHDVAGDSVVVTVN
MNGLTGAMGALPTAYSEWLLERHHIYSDKSAKAFLDIFGHRLYCLDYLAWQKNHLYARVEVEREKPLHRA
NLALTGLLNSRSIFDSEHYAHLFSSSVKSMVNLEVWLGHYYGVTVHITPFVGRWSSVDCNETCLLGMAEQ
PLGIAPMLGHFRWDIQSYFNITFGPIYESDSYPYLPDGELYQELWNRIFYYVGPGLNFKVFLNIVGGIPS
SLGEEQLGRHMCIGSKEKSRLLQVCKPFNFDNMMKGK
 
Nucleotide Sequence: 954 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c135004-134051 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGGATCTAATAACGATAGTAAGTAAATTCAATTTTTATCAACAGGTGAGAACCTTGTTGCATAAACTTC
GTACTGATGAATTATCTGGAACAGAAGTGTTGGATAAAAAGATTCACTTTGTGTCAACGCTGTCTCTTGA
CTCTCCCGATGGTCAAGTAGCGAAAATTGAGCATGATGTTGCAGGTGATTCCGTTGTAGTAACAGTGAAT
ATGAATGGCCTGACTGGTGCTATGGGTGCTTTACCAACTGCGTATAGTGAGTGGTTGTTAGAACGCCACC
ACATTTACAGCGATAAGAGTGCGAAAGCATTTTTAGATATATTTGGCCATCGATTATATTGTCTTGACTA
TTTAGCCTGGCAAAAAAATCATCTTTATGCACGAGTTGAAGTCGAGAGAGAGAAACCTCTGCATCGGGCA
AATTTGGCACTTACTGGACTATTAAACTCACGCTCAATATTTGACTCGGAGCACTATGCACATTTGTTCT
CATCCTCTGTTAAATCAATGGTCAATCTTGAAGTATGGCTAGGGCATTACTATGGAGTCACAGTTCATAT
CACACCTTTTGTAGGCAGATGGAGTTCTGTAGATTGTAACGAAACTTGCCTCTTAGGAATGGCGGAACAA
CCGCTAGGAATAGCTCCAATGCTTGGTCACTTTCGCTGGGACATACAGTCATACTTCAATATTACGTTTG
GTCCAATATACGAAAGTGATTCATACCCATATCTTCCTGATGGGGAGTTATATCAGGAACTTTGGAATCG
AATTTTTTATTACGTAGGCCCGGGGCTTAATTTTAAGGTCTTCCTTAATATTGTAGGTGGCATTCCTTCT
TCACTTGGAGAAGAACAATTAGGTAGACATATGTGTATTGGTTCTAAAGAAAAATCACGACTTCTTCAGG
TTTGTAAACCCTTCAATTTTGATAACATGATGAAAGGAAAGTGA