SecReT6
Protein ID: 345301730
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4623
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]134995..136791 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDG2SDE7
KEGG IDeas:Entas_4623
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-152, Aligned region: 5..596
Protein Sequence: 598 a.a.     [Download]
>gi|345301730|ref|YP_004821678.1| type VI secretion protein [Enterobacter asburiae LF7a]
MNRILSYYQKELAFLKKHGKAFAEQYPKIARRLGFNDGTSEDPHVERLLESFALLTSRIHQRLDDDMPEL
TEALLTSVAPQFLRSKPSTCIVEIEPDRNLSSITDKSIIPAGVQLYTRNITEAVCNFQTIYPVTLLPLTV
EEANLYFSDDDLLWHLGLKFKVWAGGKIEGEPLRFFLHGQSNVVNIIYTLICSEINKLTLKLEGKIYELK
KSDISTVGFEQSDVFIIDDPRVAPIHTLLQNYFFFPSMFHFIDVKLPSEFNATASAVFDIEITFNRMHLT
HMLEKLVNTIDAQFFRLNCTPAVNIFPQRAEPIALSENTAEYPVIVDHRKRHTISVWAINNVYIQRKQDN
TVITMPVQPLLGIDYSRNEGACDFFWQSFVRGTGNATSPYNMFISFSDRNNSNSKISTLDLVSINLTCTN
HNVPNLMVNGHPEGDFESDLPIPALKIRALSKPTRPVSPPEKGEMLWRLVSLLSLNYTLLNGHEGAKVLR
EQLKLYNWNDNPSITKMINLITYIDVEPVVSRIIKNDPQSLARGISITLTFSDEALNEPEYYLMCCFIER
YLALHAPVNSFTKVTTKIEHEEHTLRHWPVRAGKLAWI
 
Nucleotide Sequence: 1797 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c136791-134995 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAATAGAATACTTTCATACTACCAAAAGGAGCTGGCTTTCTTAAAAAAACACGGTAAAGCATTTGCAG
AACAGTATCCAAAAATTGCACGTCGTCTTGGATTTAATGATGGTACATCAGAAGACCCACATGTCGAAAG
ATTGCTAGAGTCATTTGCCTTACTTACTTCACGCATCCATCAAAGGCTTGATGATGATATGCCCGAGTTG
ACCGAAGCACTGTTGACAAGCGTAGCGCCTCAATTTTTAAGGTCTAAGCCATCCACATGTATTGTTGAGA
TAGAGCCGGATCGTAATCTTAGTAGCATTACAGATAAAAGCATAATTCCTGCAGGAGTGCAACTGTACAC
GCGTAACATTACAGAAGCTGTATGCAATTTCCAGACTATATATCCTGTAACCTTATTACCTCTTACTGTA
GAGGAAGCCAATCTTTATTTTAGTGATGATGACCTTCTTTGGCATCTGGGGCTTAAATTTAAAGTATGGG
CCGGTGGTAAAATTGAAGGCGAACCTTTACGTTTTTTTCTACATGGCCAAAGTAATGTTGTAAATATCAT
ATACACACTAATTTGTTCAGAAATTAACAAATTAACACTAAAATTGGAAGGTAAAATATATGAGTTGAAA
AAATCAGATATCAGCACTGTTGGATTTGAACAAAGTGACGTATTCATTATTGATGACCCGCGTGTGGCAC
CAATTCATACATTGCTGCAAAATTATTTTTTCTTTCCAAGTATGTTTCATTTTATAGATGTTAAATTACC
TAGTGAATTTAATGCAACAGCAAGTGCTGTTTTTGACATCGAGATTACCTTTAATCGTATGCATTTAACA
CATATGCTTGAAAAGTTGGTTAACACTATTGATGCTCAGTTCTTTCGACTCAACTGTACACCTGCAGTAA
ATATATTTCCTCAGAGAGCGGAGCCTATAGCGCTGAGCGAGAATACAGCGGAATACCCGGTTATTGTGGA
TCATCGTAAAAGACACACGATTTCGGTGTGGGCAATTAATAATGTATATATACAGAGGAAACAGGACAAT
ACAGTCATCACAATGCCTGTTCAACCATTATTAGGAATCGATTATTCACGAAACGAAGGAGCATGTGATT
TTTTTTGGCAAAGTTTTGTTCGTGGAACAGGTAATGCTACAAGCCCTTATAATATGTTTATATCATTCTC
AGACAGGAATAATAGTAACAGTAAGATATCAACGCTTGACTTAGTCTCTATTAATCTGACCTGCACTAAC
CACAATGTACCAAACCTGATGGTTAACGGTCATCCTGAGGGGGATTTCGAGTCTGATCTGCCAATACCAG
CACTGAAAATACGCGCATTAAGTAAACCTACACGTCCTGTTTCGCCACCGGAAAAAGGTGAAATGCTTTG
GCGATTAGTATCTTTACTTTCCTTAAATTATACACTTCTAAATGGTCACGAAGGCGCTAAGGTCCTACGA
GAACAGTTAAAATTGTATAATTGGAACGATAATCCATCCATAACGAAAATGATAAATTTAATAACATATA
TTGACGTAGAACCAGTAGTATCAAGGATTATAAAAAATGATCCTCAGTCCTTAGCGCGTGGCATATCAAT
TACTCTGACTTTCAGCGATGAAGCTTTGAATGAACCTGAATACTACCTTATGTGTTGTTTTATTGAGAGA
TATCTTGCTCTCCATGCCCCAGTGAATAGTTTTACGAAGGTTACAACTAAAATTGAACATGAAGAACATA
CGCTTCGACATTGGCCAGTGCGTGCAGGTAAATTAGCATGGATCTAA