SecReT6
Protein ID: 345301731
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4624
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]136784..137197 [-]
ProductgpW/GP25 family protein
NoteTssE
UniProt IDG2SDE8
KEGG IDeas:Entas_4624
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-08, Aligned region: 30..115
Cloacin_immun [PF03513], Evalue: 0.0098, Aligned region: 55..91
Protein Sequence: 137 a.a.     [Download]
>gi|345301731|ref|YP_004821679.1| gpW/GP25 family protein [Enterobacter asburiae LF7a]
MSLLQLLSDNNPTDESDSYTEENQIKFLLDELKMLFSSRTFFTYIGDVPLVNSSILNYGIDENMVEGNIN
NQQFDLIEQYIEILLSRFEPRFASVSVAINKVTIFKVYIEISAWYENYPIKLMLDWDIERRRFNLNE
 
Nucleotide Sequence: 414 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c137197-136784 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGTCGTTGTTACAGCTACTTAGCGATAACAATCCAACTGATGAAAGTGATAGCTATACGGAAGAAAATC
AAATCAAATTCCTACTTGATGAATTAAAAATGTTGTTTTCATCTCGCACTTTCTTCACATATATAGGAGA
TGTACCTCTTGTAAACTCTTCTATATTAAATTACGGCATAGATGAAAATATGGTAGAGGGAAATATCAAC
AATCAACAGTTTGACTTGATCGAACAATATATCGAGATCTTATTATCAAGATTCGAACCAAGATTCGCTA
GTGTCTCAGTGGCCATAAACAAAGTGACAATTTTCAAAGTTTATATAGAGATAAGCGCGTGGTATGAAAA
TTACCCTATAAAATTAATGCTTGACTGGGATATAGAACGCAGGAGATTTAACTTAAATGAATAG