SecReT6
Protein ID: 345301733
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4626
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]137758..139239 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDG2SDF0
KEGG IDeas:Entas_4626
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.50E-178, Aligned region: 65..488
Protein Sequence: 493 a.a.     [Download]
>gi|345301733|ref|YP_004821681.1| EvpB family type VI secretion protein [Enterobacter asburiae LF7a]
MNNERIATLSEGNAVTESYLDQIIDNTQAIRRESDRGRVRLQLNNFLEEVVSGSVVISSNLIGSIEERIV
AIDELLSKQISVIMHNTAFQKRESSWRGLQKLIKASVTDNTKIRLLQCNKQDLIKDFRSASDFDQSMLFK
CVYESEYGTFGGVPFSAFVGDFEFDNTPQDIDLLEQISHVAAAAHAPFFSAAAPGMLSMNSFTDMSRPRD
MAKLFETTDYARWRSFRQTDDSRYVGLTLPKVLGRLPYGTKTIPVESFSFEENIAENESSTDYLWVNAAY
ELAERVVSSFEDYGWCAAIRGVEGGGLVNALPAYNYISENGERLMQCPTQVAISDRREKELSDLGFIPLV
HCKGTDYAVFFAVQSVNKPRLYNSDEANANAKLTSQLPYILVTSRFAHYLKSMVRDKVGSFMSRTECQDY
LQKWIMKYVVASDVAGATTKARYPLRDARIEVVDVPGSPGTYRAIAYIKPHFQLEGVNMSLRLVADLPAA
ASS
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c139239-137758 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAACAATGAGAGAATAGCGACTTTATCAGAAGGAAATGCTGTAACGGAAAGTTACTTAGACCAGATTA
TTGATAACACACAGGCTATCCGAAGAGAGTCTGATCGCGGCAGGGTTCGCTTACAGTTGAATAATTTTCT
GGAAGAAGTTGTTTCAGGCTCGGTAGTTATATCAAGCAACCTGATTGGTAGTATAGAAGAAAGAATAGTA
GCAATTGATGAACTTTTGTCTAAGCAGATTAGTGTGATTATGCATAACACTGCATTTCAGAAGAGAGAAT
CCTCTTGGCGCGGACTTCAAAAACTAATTAAAGCCAGTGTTACTGATAATACGAAAATTCGCTTATTACA
ATGCAATAAACAAGATTTAATTAAGGATTTCAGATCGGCATCTGATTTTGATCAGTCAATGCTATTTAAG
TGTGTATATGAAAGTGAATATGGAACTTTCGGCGGTGTGCCTTTTTCTGCTTTTGTTGGCGACTTTGAGT
TTGATAATACACCACAAGATATTGACCTATTAGAACAAATTTCTCATGTGGCAGCGGCAGCTCATGCTCC
ATTTTTCAGTGCTGCTGCACCAGGTATGTTGTCTATGAATAGTTTCACGGATATGTCAAGGCCACGTGAT
ATGGCTAAACTTTTTGAAACTACTGATTATGCGCGTTGGCGCTCATTCCGACAGACTGATGATAGTCGTT
ATGTTGGACTTACATTACCTAAAGTACTCGGCCGTTTACCTTACGGTACAAAAACAATACCCGTGGAGTC
ATTCAGTTTCGAAGAGAACATAGCGGAAAATGAAAGCAGTACTGATTATCTGTGGGTCAATGCTGCCTAT
GAATTAGCAGAAAGAGTTGTAAGTTCTTTTGAGGACTATGGGTGGTGCGCTGCAATCAGAGGTGTGGAAG
GCGGGGGACTCGTTAATGCACTTCCTGCTTATAACTACATCTCAGAAAATGGTGAGCGTTTGATGCAATG
TCCAACTCAGGTTGCAATCTCTGACCGCCGTGAAAAAGAATTGTCAGATTTGGGATTTATTCCTCTTGTA
CACTGTAAGGGGACTGACTATGCAGTATTCTTCGCTGTCCAGTCAGTAAATAAACCGCGCTTATATAATT
CAGATGAGGCAAATGCAAATGCTAAGCTTACCTCACAACTTCCGTACATTCTAGTCACATCAAGATTTGC
TCATTACCTAAAGTCTATGGTTCGTGACAAAGTGGGTAGTTTTATGTCACGTACAGAATGTCAGGACTAT
CTCCAGAAATGGATTATGAAGTATGTTGTGGCTTCAGATGTTGCAGGGGCGACAACCAAAGCACGCTACC
CATTGCGTGATGCACGTATCGAAGTTGTTGATGTCCCTGGTTCACCAGGAACATATCGAGCAATTGCGTA
TATAAAACCACACTTCCAGTTGGAAGGAGTCAACATGTCACTAAGGCTGGTAGCTGACTTACCTGCAGCA
GCTAGTTCTTAA