SecReT6
Protein ID: 345301734
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4627
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]139229..139735 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDG2SDF1
KEGG IDeas:Entas_4627
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-51, Aligned region: 8..149
Protein Sequence: 168 a.a.     [Download]
>gi|345301734|ref|YP_004821682.1| type VI secretion protein [Enterobacter asburiae LF7a]
MSNTQHKLDKARPPRVQITYDVEIGDATEAKELPLVIGVMGDFTESSDSLRDRKFVSVDKDNFDEIMSSM
MPSAEFQVESVLPGKEGYIPVSLTFNSMEDFSPASIAHQVEPLKQLLELREQLSDLRNRVASNERLKEQL
LAIVEKENVSYSEGNQDQTKQPGDDNEQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c139735-139229 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAGTAATACACAACATAAATTAGATAAAGCAAGACCGCCAAGAGTACAAATCACTTATGATGTAGAAA
TTGGGGATGCAACAGAAGCTAAGGAACTACCCTTAGTTATTGGTGTAATGGGTGATTTCACCGAAAGCTC
AGACAGTTTGAGAGACAGAAAATTTGTCAGTGTGGACAAGGACAATTTTGATGAAATAATGTCATCAATG
ATGCCTTCTGCAGAATTTCAAGTGGAAAGTGTATTGCCGGGAAAGGAAGGTTATATTCCTGTATCTCTAA
CATTTAATAGTATGGAGGATTTCTCGCCAGCCAGTATTGCCCACCAGGTCGAACCTTTGAAACAGTTGTT
AGAACTTAGAGAGCAATTATCTGATTTGCGAAACCGAGTTGCCAGTAATGAACGTCTGAAAGAACAGTTA
TTGGCAATTGTAGAAAAGGAAAATGTCAGCTATTCAGAAGGAAATCAGGATCAAACTAAACAACCTGGAG
ACGATAATGAACAATGA