SecReT6
Protein ID: 346643325
SecReT6 ID35
T6SS typei3
Gene symboltagQ
Locus tagPFL_6074
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6895202..6896131 [-]
Producttype VI secretion-associated lipoprotein TagQ
NoteTagQ
UniProt IDQ4K3Q1
KEGG IDpfl:PFL_6074
PDB IDNA
Domain hit(s) vs Pfam Gly-zipper_Omp [PF13488], Evalue: 4.00E-10, Aligned region: 70..118
Gly-zipper_YMGG [PF13441], Evalue: 4.20E-10, Aligned region: 68..113
Gly-zipper_OmpA [PF13436], Evalue: 2.60E-08, Aligned region: 59..126
Gly-zipper_OmpA [PF13436], Evalue: 2.60E-08, Aligned region: 145..163
Gly-zipper_OmpA [PF13436], Evalue: 2.60E-08, Aligned region: 206..215
Rick_17kDa_Anti [PF05433], Evalue: 3.30E-06, Aligned region: 70..111
Protein Sequence: 309 a.a.     [Download]
>gi|346643325|ref|YP_263132.2| tagQ gene product [Pseudomonas fluorescens Pf-5]
MLFSRNPFASTSKRHLLLVAAGFSTVLTGCATSPVSKVASTTKVEYYPSCYEPVQHLRATDSDMTKSVVT
GAALGAAGGALLGALTGDGDHRGRNAAIGAAGGALAGGAAGYYTERQKQIADDNQRIASYAADVNKSAAD
IDRSTAYARASQTCYQRAFDSLISSRKANTINDVEGRKRLAEIVSGLKESNDLITAVNGRASEDLSKYNQ
AYEQDLQQVGVQRTDVVKVATADTTTVTTGGKRKQPQKVKQPKLPTVPQEAVSTERSIQDAKIKQAESNK
VATTGQTQVNSMCKNPDLGDWAPVPCPNV
 
Nucleotide Sequence: 930 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c6896131-6895202 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGCTTTTTTCCCGCAACCCATTTGCTTCAACGTCCAAGCGTCACCTGCTGTTGGTTGCCGCCGGGTTCA
GCACCGTATTGACCGGTTGCGCGACCTCTCCGGTGTCCAAGGTCGCCTCGACCACCAAGGTCGAGTACTA
CCCGAGCTGCTACGAGCCGGTGCAGCACCTGCGCGCCACGGATTCGGACATGACCAAGTCGGTGGTCACC
GGTGCTGCCCTGGGCGCTGCCGGCGGCGCTTTGCTCGGTGCCCTGACCGGTGACGGCGACCACCGTGGCC
GCAACGCCGCCATCGGTGCCGCAGGCGGTGCCCTGGCCGGTGGCGCAGCCGGTTACTACACCGAGCGCCA
GAAGCAGATCGCCGACGATAACCAGCGCATCGCTTCCTACGCTGCCGACGTCAACAAGAGCGCGGCCGAC
ATCGACCGCAGCACGGCCTATGCCCGCGCTTCCCAGACCTGCTACCAGCGCGCCTTCGACAGCCTGATCA
GCTCCCGCAAGGCCAACACCATCAATGACGTGGAAGGGCGCAAGCGCCTGGCGGAAATCGTCAGCGGCCT
GAAGGAGTCCAACGACCTGATCACCGCGGTGAACGGCCGTGCCAGCGAAGACCTGAGCAAGTACAACCAG
GCCTACGAGCAGGATCTGCAGCAAGTGGGCGTGCAGCGTACCGACGTGGTGAAAGTCGCCACCGCCGATA
CCACCACGGTGACCACCGGTGGCAAGAGAAAACAGCCACAGAAGGTCAAGCAGCCCAAGCTGCCGACCGT
GCCTCAGGAAGCGGTGAGCACCGAGAGGTCGATCCAGGATGCCAAGATCAAGCAGGCCGAGAGCAACAAG
GTCGCGACCACCGGCCAGACCCAGGTCAACAGCATGTGCAAGAACCCGGACCTGGGTGACTGGGCACCGG
TGCCTTGCCCTAACGTCTGA