SecReT6
Protein ID: 346643327
SecReT6 ID35
T6SS typei3
Gene symboltssA
Locus tagPFL_6086
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6912942..6913961 [+]
Producttype VI secretion protein TssA
NoteTssA
UniProt IDQ4K3N9
KEGG IDpfl:PFL_6086
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-19, Aligned region: 52..112
Protein Sequence: 339 a.a.     [Download]
>gi|346643327|ref|YP_263144.2| tssA gene product [Pseudomonas fluorescens Pf-5]
MDVPMLLAAVSATSPCGEDLEYDADFLHLERAAQGQPERSMGDSILPAEPPDWRSIQQQSLDLLARSKDL
RITHFLLQSTLALEGLPGLATSLELIDGLLRDYWADLHPRLDADDDNDPTVRINALAGLASDTTIGLLRE
AILTRSRTFGPVSLRAALNAAGLQHFSGESLGSDHLAGALQDSDPEHLDAIRSALSAARSAAESIEKQVS
EQVGSASGVDLTALKQPLRLALQVLGQHAPQGAQNAVEEHADGPSTEEPGAPAAPAPVRVSGEISSREDV
LRSLDRLLAYYSRHEPSSPLPVLLNRAKNLVNADFAAIVRNLIPDGMSQFENLRGPESD
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6912942-6913961 Pseudomonas fluorescens Pf-5 chromosome, complete genome
GTGGATGTACCGATGTTGCTCGCCGCGGTTTCAGCAACTTCGCCTTGTGGCGAAGACCTGGAATATGACG
CGGATTTCTTGCACTTGGAGCGGGCCGCACAGGGCCAGCCCGAGCGCAGCATGGGCGACTCGATCCTGCC
GGCCGAGCCGCCGGACTGGCGCAGCATCCAGCAACAGAGCCTGGACCTGCTGGCGCGCAGCAAAGACCTG
CGCATCACCCACTTCCTCCTGCAGAGCACCCTGGCCCTCGAAGGCCTGCCGGGCCTGGCCACCAGCCTCG
AACTGATCGACGGCCTGCTCCGGGATTACTGGGCGGACCTGCATCCGCGCCTGGACGCCGACGACGACAA
CGACCCCACGGTGCGTATCAACGCCCTGGCCGGCCTGGCGTCCGACACCACCATCGGCCTGCTCCGCGAA
GCCATCCTGACCCGTTCCCGGACCTTCGGCCCGGTGAGCCTGCGAGCCGCGCTGAACGCCGCCGGCCTGC
AGCACTTTTCCGGCGAGAGCCTGGGCTCCGACCACCTGGCCGGCGCCCTGCAAGACAGCGACCCCGAGCA
CCTGGATGCGATTCGCAGCGCCTTGAGCGCAGCCCGCTCGGCGGCCGAAAGCATCGAGAAACAGGTCAGC
GAACAAGTAGGCTCGGCCAGCGGTGTAGACCTCACGGCCCTCAAGCAACCCCTGCGCCTGGCGCTACAGG
TGCTGGGCCAGCACGCCCCGCAAGGCGCGCAGAACGCGGTCGAGGAACACGCCGATGGGCCGTCCACCGA
AGAGCCAGGTGCGCCCGCAGCGCCAGCCCCGGTACGGGTTTCCGGCGAGATCAGCAGCCGCGAAGACGTG
CTGCGCAGCCTTGACCGGCTGCTGGCCTACTACAGCCGCCACGAGCCTTCGAGCCCGTTGCCGGTGCTGC
TCAACCGGGCCAAGAACCTGGTCAACGCCGACTTCGCGGCCATCGTGCGCAATCTGATTCCCGACGGCAT
GTCCCAATTTGAAAACCTGCGCGGCCCTGAATCCGACTAA