SecReT6
Protein ID: 346643328
SecReT6 ID35
T6SS typei3
Gene symboltssE
Locus tagPFL_6090
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6916836..6917351 [+]
Producttype VI secretion protein TssE
NoteTssE
UniProt IDQ4K3N5
KEGG IDpfl:PFL_6090
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-23, Aligned region: 37..146
Protein Sequence: 171 a.a.     [Download]
>gi|346643328|ref|YP_263148.2| tssE gene product [Pseudomonas fluorescens Pf-5]
MVTDIAARDRLQPSLLDRLTDDEPGNLKESPDKRVLSLSQLKASVLRDLAWLLNTTSLLEADATLHTPAG
TSVVNYGLPALAGYSASSIDIPALEALIHQAIATFEPRILRSTLRVRARTAPGEMNHNALSFEIEGDLWA
QPMPLRLLLQTDMDLESGHVRVVHADSRRRS
 
Nucleotide Sequence: 516 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6916836-6917351 Pseudomonas fluorescens Pf-5 chromosome, complete genome
TTGGTAACCGACATCGCCGCCCGCGATCGCTTGCAACCCTCCCTGCTGGATCGTCTGACCGACGATGAAC
CCGGCAACCTGAAAGAAAGCCCGGACAAACGCGTGCTGTCCCTGAGCCAGCTCAAGGCCTCGGTACTGCG
CGACCTGGCATGGCTGCTCAACACCACTTCCCTGCTGGAAGCCGACGCCACCCTGCACACACCCGCCGGT
ACTTCGGTGGTCAACTACGGCCTGCCGGCCCTGGCCGGGTACAGCGCTTCGAGCATCGATATCCCGGCCC
TGGAGGCGCTGATCCACCAGGCCATCGCCACCTTTGAGCCGCGCATCCTGCGCAGCACCCTGCGGGTACG
CGCACGCACCGCGCCCGGGGAAATGAACCACAACGCCCTGAGCTTCGAGATCGAAGGCGACCTCTGGGCC
CAGCCGATGCCCCTGCGTCTGCTGCTGCAAACCGACATGGACCTGGAATCGGGACACGTACGAGTGGTGC
ACGCCGACTCCCGGAGGCGCTCATGA