SecReT6
Protein ID: 346724999
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2098
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2402560..2403066 [+]
Producthypothetical protein
NoteTssB
UniProt IDG2LT73
KEGG IDxax:XACM_2098
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.20E-56, Aligned region: 11..164
Protein Sequence: 168 a.a.     [Download]
>gi|346724999|ref|YP_004851668.1| hypothetical protein XACM_2098 [Xanthomonas axonopodis pv. citrumelo F1]
MSVRSSSQKFIARNRAPRVQIEYDVEIYGSQKKVQVPFVMGVLSDLSGANTENLPALEAREAVEIDVDNF
DSRLRAMQPRVAMSVSNTLTGSGELPVDITFDSLDDFSPTAVVKKVAPLAELLEARTQLANLGTYLDGKA
GAERLIADAIKDPTLLRSLVAAPKSTDE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2402560-2403066 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGTCCGTTCGCAGCAGCAGTCAGAAGTTCATTGCCAGGAATCGCGCGCCTCGCGTGCAGATCGAATACG
ACGTCGAGATCTACGGCTCGCAGAAGAAGGTGCAGGTTCCGTTCGTCATGGGGGTGTTGTCGGACCTGTC
CGGCGCCAATACAGAAAACCTGCCGGCGCTGGAAGCACGCGAGGCAGTGGAAATCGATGTCGACAATTTC
GACAGCCGGCTGCGTGCCATGCAACCGCGGGTGGCAATGAGCGTTTCCAACACCCTCACCGGCAGCGGCG
AATTACCTGTCGATATCACCTTCGACAGCCTGGACGATTTTTCGCCCACCGCCGTGGTGAAAAAGGTGGC
ACCGCTGGCCGAGCTGCTGGAAGCGCGTACGCAACTGGCCAATCTGGGCACGTATCTCGACGGCAAGGCC
GGCGCCGAGCGCCTGATCGCCGATGCGATCAAGGATCCCACCTTGCTGCGCTCGCTGGTCGCGGCCCCCA
AGTCGACGGATGAGTAA