SecReT6
Protein ID: 346725000
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2099
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2403071..2404579 [+]
Producthypothetical protein
NoteTssC
UniProt IDG2LT74
KEGG IDxax:XACM_2099
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-193, Aligned region: 71..497
Protein Sequence: 502 a.a.     [Download]
>gi|346725000|ref|YP_004851669.1| hypothetical protein XACM_2099 [Xanthomonas axonopodis pv. citrumelo F1]
MATQNSSAAQDLADAQPQLTSQSDDFAALLTREFRPRSERAGEEVRLAVRTLAEQVLERSDIISDDLAQT
INAYVAEIDRKITEQLNLILHAPQFQALEGAWRGLHYLVSNTESDTQLKIRVLNVSKKELAKNLKRFKGT
AWDQSPVFKKIYEAEYGQLGGEPYGCLIGDYHFDHSPQDVDTLRGISQIAAASHAPFIAAAGPGLMGMES
WSELSNPRDLAKIFSTPDYAAWRSLRQSEDAKYLALAMPRTLARLPYGAKTDPVEAFDFEEDTQGADSSR
YTWQNAAYAMAVNINRSFKQYGWCTRIRGVESGGAVEGLPTHTFPADDGGVDMKCPTEVAITDRRSAELD
KMGLMPLVHRKNTDMAAFIGAQSLGKPEEYDDPDATANAALSARLPYMFACCRFAHYLKCIVRDKIGSFS
TRQQMQSWLTDWVMNYVDGDPANSSEETKARKPLAAAEVVVEEVEGNPGYYTSKFYLRPHYQLEGLTVSL
RLVSRLPSAQAA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2403071-2404579 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCGACCCAGAATTCTTCCGCTGCCCAAGACCTTGCCGATGCCCAGCCGCAGCTAACCAGCCAATCCG
ACGACTTTGCGGCGCTGCTGACCCGCGAATTCCGTCCGCGCAGCGAACGCGCCGGCGAAGAAGTGCGGTT
GGCTGTGCGCACCCTGGCCGAACAGGTGCTGGAACGCAGCGACATCATCAGCGACGACCTCGCGCAGACC
ATCAATGCGTATGTTGCCGAGATCGACCGCAAGATCACCGAGCAACTCAATCTCATCCTGCACGCACCGC
AGTTCCAGGCGCTGGAGGGTGCATGGCGCGGCCTGCATTATCTGGTGAGCAATACCGAATCGGACACGCA
GTTGAAGATCCGCGTGCTCAACGTGTCCAAGAAGGAGCTCGCCAAGAACCTCAAGCGCTTCAAGGGCACC
GCCTGGGACCAAAGCCCGGTGTTCAAGAAGATCTACGAAGCCGAGTATGGTCAGCTGGGTGGCGAACCGT
ATGGCTGCCTGATCGGCGATTACCACTTCGACCACAGCCCGCAGGATGTCGACACGTTGCGCGGCATCAG
CCAGATTGCGGCCGCCTCGCATGCGCCCTTCATCGCCGCTGCGGGTCCCGGACTGATGGGGATGGAAAGC
TGGAGCGAGCTCTCCAACCCGCGCGATCTGGCCAAGATTTTTTCCACACCCGATTACGCGGCATGGCGGT
CGTTGCGCCAGAGCGAGGATGCCAAATACCTGGCGCTGGCCATGCCACGCACGCTGGCACGGCTGCCGTA
CGGCGCCAAGACCGATCCGGTGGAAGCGTTCGACTTCGAAGAAGACACTCAGGGCGCCGATTCGTCGCGC
TACACCTGGCAAAACGCAGCCTACGCAATGGCGGTCAACATCAACCGCTCATTCAAGCAGTACGGCTGGT
GCACGCGCATTCGCGGCGTGGAGTCGGGTGGGGCGGTGGAAGGCCTGCCGACGCACACCTTCCCGGCCGA
CGATGGCGGTGTGGACATGAAGTGCCCGACCGAGGTCGCCATCACCGACCGCCGTTCGGCGGAACTGGAC
AAGATGGGCCTGATGCCGCTGGTGCATCGCAAGAACACCGACATGGCCGCCTTCATCGGTGCACAGTCGC
TGGGCAAGCCCGAGGAGTACGACGACCCGGATGCCACCGCCAACGCAGCGCTGAGCGCACGGCTGCCGTA
TATGTTCGCTTGCTGCCGTTTCGCGCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAGC
ACGCGCCAGCAAATGCAGAGCTGGTTGACCGATTGGGTGATGAACTACGTCGACGGCGACCCGGCCAATT
CCAGCGAAGAAACCAAGGCACGCAAGCCCTTGGCCGCCGCCGAAGTGGTGGTCGAAGAGGTCGAAGGTAA
CCCCGGTTACTACACCTCCAAGTTTTACCTGCGCCCGCATTACCAGCTCGAAGGCCTGACGGTATCGCTA
CGCCTGGTCTCGCGCTTGCCATCGGCGCAAGCCGCCTGA