SecReT6
Protein ID: 346725001
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2100
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2404679..2405182 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDG2LT75
KEGG IDxax:XACM_2100
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-36, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|346725001|ref|YP_004851670.1| hemolysin-coregulated protein [Xanthomonas axonopodis pv. citrumelo F1]
MAFDMHLKFGSGDVEIKGASNHSKHKDEVPIIAWSWGTSNTGNLHTGAGYAAGGKANVQDISVTKYVDSC
SNALLNACCTGARVDSATLYVTNATGEQTDYVTIELSEGVMITSVSTGGSGGEDRLTENVTLHFGKFKYS
FQPQDDKGKKQGGTKDFTFNMQEVKKS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2404679-2405182 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCTTTCGATATGCATCTCAAATTCGGCTCGGGCGACGTCGAGATCAAGGGCGCGTCCAACCATTCCA
AGCACAAGGACGAAGTGCCGATCATTGCCTGGTCGTGGGGTACCAGCAACACCGGCAACCTGCACACCGG
CGCTGGCTATGCGGCCGGCGGCAAGGCCAACGTGCAGGATATTTCCGTCACCAAGTACGTCGACAGCTGC
TCCAACGCCTTGCTCAATGCCTGCTGCACGGGTGCGCGTGTGGATTCGGCCACGTTGTACGTGACCAACG
CCACCGGCGAGCAGACCGACTACGTCACCATCGAGCTGAGCGAGGGCGTGATGATCACCTCGGTGTCCAC
CGGCGGCAGCGGTGGCGAAGATCGTCTGACCGAAAACGTGACGCTGCATTTCGGCAAGTTCAAGTACTCG
TTCCAGCCGCAGGACGACAAGGGCAAGAAGCAGGGCGGCACCAAGGACTTCACCTTCAACATGCAGGAAG
TGAAGAAGTCCTGA