SecReT6
Protein ID: 346725002
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2101
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2405215..2406048 [+]
ProductProtein of avirulence locus involved in temperature-dependent protein secretion
NoteTagJ
UniProt IDG2LT76
KEGG IDxax:XACM_2101
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.70E-42, Aligned region: 144..266
Protein Sequence: 277 a.a.     [Download]
>gi|346725002|ref|YP_004851671.1| Protein of avirulence locus involved in temperature-dependent protein secretion [Xanthomonas axonopodis pv. citrumelo F1]
MSIIHPEHACARLIKADNPEASLATAKEWVRQCPADAQARIGLFQLLAVVGDWERARQQLLLAADLDQAW
IGVAGAYARILDAEREREQVLAGRMMPLMPGQVPQWQHDLLQALQHDRDGEPAQAARRRALALTQADAIA
GHVDGERFDWLADADPRFGPCLEVILEAGYAWLPFAQLRSLRFEVPGSLRDMLWQSVEIQWRDGTHSRGV
VPCRYPGSHHSDDGAIRLGKRTTWQGEDLSACGLGQRLLAGSEDDYPLLDIRHIAFDTAAVAAPWPN
 
Nucleotide Sequence: 834 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2405215-2406048 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGTCCATCATCCATCCCGAACATGCCTGCGCCCGCCTGATCAAGGCAGACAATCCCGAGGCCTCGTTGG
CGACCGCCAAGGAGTGGGTGCGGCAATGCCCGGCCGATGCCCAAGCGCGCATCGGCTTGTTCCAGCTGCT
GGCCGTGGTGGGCGACTGGGAGCGGGCGCGGCAGCAGTTGCTGCTGGCGGCAGACCTGGATCAGGCCTGG
ATCGGCGTGGCTGGCGCGTATGCGCGCATCCTCGACGCCGAACGTGAGCGCGAGCAGGTGCTGGCCGGTC
GGATGATGCCACTGATGCCTGGTCAGGTACCGCAGTGGCAACACGATCTGCTGCAGGCATTGCAACACGA
TCGCGACGGCGAGCCAGCGCAGGCCGCACGACGGCGTGCGCTGGCGCTGACTCAAGCCGATGCCATCGCG
GGGCACGTCGATGGCGAACGTTTCGACTGGTTGGCGGACGCCGATCCACGGTTTGGGCCTTGCCTGGAGG
TCATCCTCGAAGCGGGCTACGCCTGGCTGCCGTTCGCCCAACTGCGCAGCCTGCGTTTCGAGGTGCCTGG
CAGTCTGCGCGACATGCTGTGGCAATCGGTGGAAATTCAATGGCGCGACGGCACGCACAGCCGTGGCGTG
GTGCCTTGTCGTTACCCCGGCAGCCACCACAGCGACGACGGCGCGATCCGTCTCGGCAAGCGCACCACCT
GGCAGGGCGAAGACCTGTCTGCCTGCGGTCTGGGGCAACGCCTGCTGGCCGGCAGCGAAGACGACTACCC
CTTGCTCGATATTCGCCATATTGCATTCGACACCGCCGCGGTGGCAGCGCCATGGCCGAACTGA