SecReT6
Protein ID: 346725003
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2102
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2406036..2406539 [+]
Producthypothetical protein
NoteTssE
UniProt IDG2LT77
KEGG IDxax:XACM_2102
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-19, Aligned region: 37..144
Protein Sequence: 167 a.a.     [Download]
>gi|346725003|ref|YP_004851672.1| hypothetical protein XACM_2102 [Xanthomonas axonopodis pv. citrumelo F1]
MAELTQQERLQPSLLDRLIDDRRHELAESRDARAIGPAKLRDCVMRDLTWLLNCTRHWHEDALQAYPHVA
TSVLNYGIPDLAGARLAGLDVVELQNRIHAAIVAFEPRLAAASLQVTAKVDTGRMDRMSLSFVIDSELWA
QPLPLALYLRTDLDLETGRFSLSSGAH
 
Nucleotide Sequence: 504 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2406036-2406539 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCCGAACTGACCCAACAAGAGCGGCTGCAGCCCTCGCTGCTGGACCGTTTGATCGACGACCGTCGGC
ATGAGCTGGCCGAGAGCCGCGACGCGCGCGCGATCGGTCCGGCCAAGCTGCGCGACTGCGTCATGCGCGA
CCTGACCTGGTTGCTCAACTGCACCCGCCATTGGCATGAGGACGCGCTGCAAGCGTATCCGCATGTCGCC
ACCTCGGTGCTCAATTACGGCATTCCCGATCTGGCCGGCGCGCGCCTGGCCGGACTGGACGTGGTCGAGC
TGCAGAACCGCATCCACGCCGCCATCGTGGCGTTCGAGCCGCGGCTCGCTGCGGCCAGCCTGCAGGTCAC
CGCCAAGGTCGATACCGGGCGCATGGACCGCATGTCGCTGTCCTTCGTCATCGACTCCGAACTCTGGGCG
CAGCCATTGCCATTGGCGCTGTATCTGCGCACCGATCTCGACCTGGAAACCGGTCGCTTCAGTCTGTCGT
CCGGAGCGCACTGA