SecReT6
Protein ID: 346725004
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2103
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2406542..2408419 [+]
Producthypothetical protein
NoteTssF
UniProt IDG2LT78
KEGG IDxax:XACM_2103
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.40E-215, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|346725004|ref|YP_004851673.1| hypothetical protein XACM_2103 [Xanthomonas axonopodis pv. citrumelo F1]
MDPRLLHHYNRELQHVREMGAEFAQAYPKVAGRLGMSGIECADPYVERLLEGFAFLSARVQLELEAQQPV
FAQHLMDMLYPHFLSPVPSMAVVELQPEQGEGIGPAGHLVPRGSALRSLIGHGDRTACEYRTAHAVTLWP
LRLTAARYLASPAALATLGVPVESRARAGLRLVFTVNAGLRLDMLALDTLPIFITGADGLAGSLYEQLHA
NALGFVVRARAADGQVLSRNFGPEHLQPQGFDDEQALLPRSERSFSGYRLLQEYFACPERFLFAAFDGLA
QVLPRAACTEFEIVVWFDRAVERLDNAVDASNFRLHCTPAINLFPRRGDRIHLQPGICEHHVLADRTRPM
DFEIHGVEQVEGFGDGNTPMQRFEPFYGAQPRSWHERRSAFYALRRQPRRLSTGQRRTGPRSSYVGSEVF
LSLVDGDQAPYPHQLRQLGMQLWCSNRDLPLHMPVGKSSTDFVLDDGGPVAAIRCVAGPTRPRSGVTAGD
TRWRLISHLQLNYLSLLEAGDDGATAVREMLTLYHDPHDAAARRQVEGVRRIASRPIVRRIPVPGPATYG
RGLEITLTCDDAAFEGQGVYLLASVLRHVFARQASLNSFTETVLCTLERNEVVRWPSHLGNRPIL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2406542-2408419 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGATCCGCGCCTGCTCCACCACTACAACCGCGAGTTGCAGCATGTGCGCGAGATGGGCGCGGAGTTCG
CGCAGGCGTATCCGAAGGTCGCCGGCCGGCTCGGCATGAGCGGCATCGAGTGCGCCGACCCGTATGTCGA
ACGCCTGCTGGAAGGGTTCGCGTTCCTGTCCGCGCGCGTGCAACTCGAATTGGAGGCACAGCAACCGGTA
TTCGCCCAGCACCTGATGGACATGCTGTATCCGCACTTCCTGTCGCCGGTGCCGTCGATGGCCGTGGTGG
AGCTGCAACCGGAGCAGGGCGAGGGCATCGGTCCGGCGGGGCATCTTGTGCCGCGTGGCAGCGCGCTGCG
CTCGTTGATCGGGCACGGCGACCGCACGGCCTGCGAGTATCGTACGGCGCATGCGGTGACGCTGTGGCCG
CTGCGTCTGACCGCCGCCAGGTACCTGGCCTCGCCGGCGGCGCTGGCCACGCTTGGCGTGCCGGTCGAGT
CGCGCGCGCGCGCCGGCCTGCGGTTGGTTTTCACTGTGAATGCCGGGCTGCGTCTGGACATGCTGGCGCT
GGACACACTGCCGATCTTCATCACCGGCGCCGACGGACTGGCCGGCAGCCTCTATGAGCAACTGCATGCC
AATGCGTTGGGATTCGTGGTGCGTGCCCGCGCCGCGGATGGGCAGGTGCTCAGTCGCAACTTCGGCCCCG
AGCATCTGCAGCCACAGGGCTTCGACGATGAGCAGGCATTGCTGCCGCGCAGTGAGCGCTCCTTCAGCGG
CTATCGTCTGTTGCAGGAATACTTCGCTTGCCCAGAGCGCTTCCTGTTCGCCGCCTTCGATGGCCTGGCA
CAGGTGCTGCCGCGCGCGGCCTGCACCGAGTTCGAGATTGTGGTGTGGTTCGATCGTGCCGTCGAACGGC
TCGACAATGCCGTGGATGCGAGCAATTTCCGCCTGCATTGCACCCCGGCCATCAACCTGTTCCCCAGGCG
CGGCGATCGCATCCATCTGCAGCCCGGCATCTGCGAGCATCATGTGCTGGCCGACCGCACGCGGCCGATG
GACTTCGAGATCCATGGCGTGGAGCAGGTCGAGGGCTTCGGCGATGGCAATACGCCGATGCAGCGTTTCG
AGCCGTTCTATGGCGCGCAGCCGCGTAGCTGGCATGAGCGGCGCTCGGCGTTTTATGCGCTGCGGCGTCA
GCCGCGGCGGCTGTCGACCGGGCAACGCCGCACCGGGCCGCGCTCGAGCTACGTCGGCAGCGAAGTGTTC
CTGTCGCTGGTCGATGGCGATCAGGCGCCCTATCCGCATCAGCTGCGGCAATTGGGCATGCAGCTGTGGT
GCAGCAACCGCGATCTGCCGCTGCATATGCCGGTGGGCAAATCCAGCACCGACTTCGTGCTGGACGATGG
CGGCCCGGTGGCGGCGATCCGCTGCGTGGCCGGTCCAACGCGACCGCGCTCGGGCGTGACCGCCGGCGAT
ACCCGCTGGCGCCTGATCAGCCATCTTCAGTTGAACTATCTCTCGCTGCTGGAGGCCGGCGACGACGGCG
CCACCGCAGTGCGCGAGATGCTCACGCTCTACCACGACCCGCACGATGCCGCGGCGCGGCGCCAGGTCGA
GGGCGTGCGCCGCATTGCCTCACGCCCGATCGTGCGCCGCATTCCGGTGCCGGGCCCGGCCACCTATGGC
CGCGGGCTGGAGATCACCTTGACCTGCGACGACGCCGCGTTCGAAGGGCAGGGCGTCTACCTGCTCGCCT
CGGTGCTGCGGCATGTCTTCGCCCGCCAGGCATCGCTGAATTCCTTTACCGAAACCGTGCTGTGCACGCT
CGAACGTAACGAGGTCGTCCGATGGCCATCCCATCTCGGCAATCGGCCGATCCTCTAG