SecReT6
Protein ID: 346725005
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2104
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2408383..2409393 [+]
Producthypothetical protein
NoteTssG
UniProt IDG2LT79
KEGG IDxax:XACM_2104
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-107, Aligned region: 20..321
Protein Sequence: 336 a.a.     [Download]
>gi|346725005|ref|YP_004851674.1| hypothetical protein XACM_2104 [Xanthomonas axonopodis pv. citrumelo F1]
MAIPSRQSADPLALLAHLEAQPRDFELFEALRRLECAHPAQPRLGQAARPLEEPVRLGQRASLEFPPRDI
DSLQPGPDGLPPTLRTLALGLFGPHGALPLHLTEHAIEREGAGDPTFAAFADIFHHRMIALWYRAWADAR
PTVQMDRPGEDRFGARLDALTGVDQPALRGRDAMPLAARRHFAGRFVAQARNAEGLRAVLIGLFDVAVQV
QEFVANWLPLPEEGRLRMGRAAARMGRDATLGASARNAQHRFRLRIGPLEIARYREFLPGGQALEVLTAA
VRGYVGDEQAWDLQLVLAREDVPLPLMGQGQRIGLSLWLGHYRRPRDADQLVLAPS
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2408383-2409393 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCCATCCCATCTCGGCAATCGGCCGATCCTCTAGCGTTGCTGGCGCACCTGGAGGCGCAGCCGCGGG
ACTTCGAGTTGTTCGAAGCGTTGCGGCGGCTGGAGTGCGCGCATCCGGCGCAACCGCGTCTGGGCCAGGC
AGCACGGCCGTTGGAGGAGCCGGTGCGCTTGGGGCAGCGCGCCTCGCTGGAGTTCCCGCCGCGCGATATC
GACAGCCTGCAACCGGGCCCGGACGGTCTTCCGCCGACGCTGCGGACGCTGGCCTTGGGTTTGTTCGGCC
CGCATGGCGCGCTGCCGCTGCATCTGACCGAACACGCGATCGAACGCGAAGGGGCTGGTGACCCGACCTT
CGCCGCCTTCGCCGACATCTTCCACCACCGCATGATCGCGCTGTGGTACCGCGCCTGGGCCGATGCGCGC
CCGACCGTGCAGATGGATCGTCCGGGCGAGGACCGCTTTGGCGCGCGGCTGGATGCGCTGACCGGCGTGG
ACCAACCCGCGCTGCGCGGCCGCGATGCGATGCCGTTGGCCGCACGCCGGCACTTCGCTGGCCGCTTCGT
CGCCCAGGCACGCAATGCCGAAGGCCTGCGTGCGGTGCTGATCGGCCTGTTCGATGTCGCCGTGCAGGTG
CAGGAATTCGTTGCCAACTGGTTGCCGTTACCCGAAGAAGGACGGCTGCGGATGGGACGTGCTGCTGCGC
GCATGGGGCGTGACGCCACGCTAGGCGCATCGGCGCGCAACGCCCAACACCGCTTTCGCCTGCGGATCGG
CCCCTTGGAGATCGCCCGCTACCGCGAGTTCCTGCCGGGCGGCCAGGCCCTGGAAGTACTGACCGCCGCA
GTACGCGGCTACGTCGGCGACGAGCAGGCCTGGGACCTGCAATTGGTGCTGGCGCGCGAAGACGTCCCGT
TGCCGCTGATGGGGCAGGGCCAGCGCATCGGCCTGTCGCTCTGGCTCGGCCACTATCGCCGCCCGCGCGA
TGCCGACCAGCTTGTACTCGCACCGTCCTGA