SecReT6
Protein ID: 346725006
SecReT6 ID460
T6SS typei3
Gene symbolclpB1
Locus tagXACM_2105
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2409426..2412164 [+]
ProductATP-dependent Clp protease subunit
NoteTssH
UniProt IDG2LT80
KEGG IDxax:XACM_2105
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-40, Aligned region: 225..245
AAA_2 [PF07724], Evalue: 1.00E-40, Aligned region: 645..811
AAA [PF00004], Evalue: 1.40E-17, Aligned region: 225..337
AAA [PF00004], Evalue: 1.40E-17, Aligned region: 651..735
ClpB_D2-small [PF10431], Evalue: 7.00E-15, Aligned region: 818..894
AAA_5 [PF07728], Evalue: 5.80E-12, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 5.80E-12, Aligned region: 359..392
AAA_5 [PF07728], Evalue: 5.80E-12, Aligned region: 650..768
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 516..560
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 621..693
AAA_16 [PF13191], Evalue: 2.00E-10, Aligned region: 715..736
Sigma54_activat [PF00158], Evalue: 4.30E-07, Aligned region: 203..247
Sigma54_activat [PF00158], Evalue: 4.30E-07, Aligned region: 649..763
Zeta_toxin [PF06414], Evalue: 5.00E-06, Aligned region: 224..247
Zeta_toxin [PF06414], Evalue: 5.00E-06, Aligned region: 649..690
Zeta_toxin [PF06414], Evalue: 5.00E-06, Aligned region: 820..857
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 36..77
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 224..259
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 358..391
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 648..673
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 712..734
AAA_14 [PF13173], Evalue: 5.10E-05, Aligned region: 225..293
AAA_14 [PF13173], Evalue: 5.10E-05, Aligned region: 331..391
AAA_14 [PF13173], Evalue: 5.10E-05, Aligned region: 649..760
NACHT [PF05729], Evalue: 6.10E-05, Aligned region: 225..252
NACHT [PF05729], Evalue: 6.10E-05, Aligned region: 650..677
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 225..253
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 650..688
AAA_25 [PF13481], Evalue: 0.00016, Aligned region: 220..301
AAA_25 [PF13481], Evalue: 0.00016, Aligned region: 351..396
AAA_25 [PF13481], Evalue: 0.00016, Aligned region: 648..675
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 222..248
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 648..672
Arch_ATPase [PF01637], Evalue: 0.0007, Aligned region: 203..245
Arch_ATPase [PF01637], Evalue: 0.0007, Aligned region: 276..332
Arch_ATPase [PF01637], Evalue: 0.0007, Aligned region: 649..691
Arch_ATPase [PF01637], Evalue: 0.0007, Aligned region: 716..732
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 218..246
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 650..669
AAA_29 [PF13555], Evalue: 0.0047, Aligned region: 217..240
AAA_29 [PF13555], Evalue: 0.0047, Aligned region: 648..675
AAA_18 [PF13238], Evalue: 0.0048, Aligned region: 225..245
AAA_18 [PF13238], Evalue: 0.0048, Aligned region: 651..681
DUF815 [PF05673], Evalue: 0.0062, Aligned region: 215..300
DUF815 [PF05673], Evalue: 0.0062, Aligned region: 649..688
Protein Sequence: 912 a.a.     [Download]
>gi|346725006|ref|YP_004851675.1| ATP-dependent Clp protease subunit [Xanthomonas axonopodis pv. citrumelo F1]
MADISRAALFGKLNKTTYRGIESATAFCRLRGDREVDLLHWLHQLLQAQDGDLHRIVRHFSLDAARLAQD
LTAALDRLPRGGGGHFDLSASVEEAVERAWVHCTLRYGRQRIRGGDLLVAILHTRSLRNGLLAMSSEFGK
LRAEALADDLDAIVAGSPEDDATDIAAASAPAGPTAAGGTAALALYTVDLTAQAREGKLDPIIGRDDEIR
QVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGDVPPALKDVQLRTLDVGLLQAGASMKGEFEQR
LRAVIDEVQASPKPIILFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTVGATTFAEYKKYIEKDPA
LTRRFQAVQVDEPDEAKAVRMMRGVASMMEQHHRVQILDEALEAAVKLSHRYIPARQLPDKSVSLLDTAC
ARVAVSLHATPAEVDDSRRRIESLETEHAIIERERAIGIVVDERAAACASLLQSEHGRLHELEQRWVGEK
ALVDELLSLRAQLRSGNSSVEGTGSALEAEADTDADAAADAAVAQSASGDTAVLDAPVQVDRDTLLARLQ
LVQAELAALQGESPLILPTVDYQAVAAVVADWTGIPVGRMARNEIDTVLRLPELLAKRVIGQDHAMEMIA
KRIQTSRAGLDNPDKPIGVFLLAGTSGVGKTETALALAETLYGGEQNLITINMSEYQEAHTVSSLKGAPP
GYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHELFFQVFDKGWMEDGEGRRIDFRNTLIILTSNAG
TDLIASLCKDPELIPDPEAMAKAIREPLLKVFPPALLGRLVAIAYYPLSNDMLGQIVRLQLNRIKKRIEE
RYKIPFEYDHSVVELVVSRCTESESGGRMIDAILTNSMLPEISRQFLTRVIEGKKINHSRASAVADDFFY
EF
 
Nucleotide Sequence: 2739 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2409426-2412164 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCAGACATCAGTCGCGCCGCCTTGTTCGGCAAGCTCAACAAGACCACGTATCGCGGCATCGAATCGG
CCACCGCCTTCTGCAGGCTGCGTGGCGACCGCGAGGTGGATCTGCTGCATTGGCTGCATCAGTTGCTGCA
GGCGCAAGACGGCGACCTGCATCGCATCGTGCGTCATTTTTCGCTCGATGCGGCGCGACTTGCGCAGGAC
CTGACCGCAGCGCTCGATCGGCTGCCGCGCGGCGGTGGCGGGCACTTCGATCTGTCGGCCAGCGTGGAAG
AAGCAGTGGAACGCGCCTGGGTGCACTGCACGTTGCGCTACGGCCGGCAACGCATCCGTGGCGGCGACCT
GCTGGTGGCGATCCTGCATACGCGCAGCCTGCGCAACGGCTTGCTGGCCATGTCCAGCGAGTTCGGCAAG
CTGCGCGCGGAAGCACTAGCGGACGATCTGGACGCCATCGTCGCCGGCTCGCCGGAGGACGATGCCACCG
ATATTGCGGCGGCCAGCGCTCCCGCCGGACCAACCGCCGCTGGTGGGACTGCTGCGCTCGCGCTGTATAC
GGTCGATCTCACCGCACAGGCACGCGAGGGCAAGCTGGACCCGATCATCGGCCGCGACGACGAGATCCGC
CAGGTCGTCGATATCCTGATGCGCCGCCGCCAGAACAACCCGATCCTGGTTGGCGAGGCCGGTGTCGGTA
AGACCGCGGTGGTGGAAGGCTTCGCACAACGCATCGCGCGCGGCGATGTGCCGCCCGCGTTGAAGGACGT
GCAGCTGCGCACGCTGGATGTGGGCCTGCTGCAGGCCGGCGCCAGCATGAAGGGCGAATTCGAGCAACGC
CTGCGCGCAGTCATCGACGAAGTGCAGGCCAGCCCCAAGCCGATCATTCTGTTTGTGGATGAAACCCACA
CCCTGGTCGGCGCCGGTGGCGCGGCCGGTACCGGCGATGCGGCCAACCTGCTCAAGCCCGCACTGGCGCG
TGGCACCTTGCGCACCGTGGGGGCGACCACGTTTGCCGAGTACAAGAAGTACATCGAAAAGGATCCGGCA
TTGACGCGGCGCTTCCAGGCCGTGCAGGTGGACGAGCCGGACGAGGCCAAGGCGGTGCGCATGATGCGCG
GCGTCGCTTCGATGATGGAACAGCACCACCGTGTGCAGATCCTGGACGAAGCGCTGGAAGCGGCGGTCAA
GCTCAGTCACCGCTACATCCCGGCGCGGCAGCTGCCGGACAAATCGGTGAGCCTGCTCGACACCGCCTGC
GCGCGCGTGGCGGTGAGCCTGCACGCTACGCCTGCGGAAGTGGACGACAGTCGCCGCCGCATCGAATCGC
TGGAGACCGAGCACGCCATCATCGAACGCGAGCGTGCGATTGGCATCGTGGTGGATGAGCGTGCTGCAGC
TTGCGCCAGCCTGCTGCAAAGCGAGCACGGCCGCCTGCACGAGCTGGAACAGCGCTGGGTTGGCGAGAAG
GCATTGGTGGACGAGCTGTTGTCGTTGCGCGCACAACTGCGTAGCGGTAATTCATCGGTGGAAGGCACCG
GCAGTGCGTTGGAAGCAGAGGCCGACACCGACGCAGATGCCGCCGCAGATGCCGCTGTCGCGCAGTCGGC
GTCTGGCGACACTGCCGTGCTCGACGCACCGGTACAAGTTGATCGCGACACCTTACTGGCACGTCTGCAG
CTGGTGCAGGCTGAACTGGCAGCATTACAAGGCGAATCGCCGCTGATCCTACCCACGGTCGATTACCAGG
CGGTCGCCGCCGTGGTCGCCGACTGGACCGGCATCCCGGTCGGGCGCATGGCGCGCAACGAGATCGACAC
CGTGCTGCGCCTGCCCGAGCTGCTGGCCAAGCGCGTGATCGGCCAGGACCACGCCATGGAAATGATCGCC
AAGCGCATCCAGACCAGCCGCGCCGGTCTGGACAACCCGGACAAACCGATCGGCGTGTTCCTGCTGGCCG
GCACCTCCGGCGTGGGCAAGACCGAAACCGCACTCGCGCTGGCCGAAACCTTGTACGGCGGCGAACAAAA
TCTGATCACCATCAACATGAGCGAGTACCAGGAAGCGCATACCGTCTCCTCGCTCAAGGGTGCACCGCCG
GGCTATGTGGGCTACGGCGAAGGCGGCGTGCTCACCGAAGCGGTGCGCCGCAAGCCGTACTCGGTCGTGT
TGCTGGACGAAGTGGAAAAAGCCCACCCGGACGTGCACGAACTGTTCTTCCAGGTCTTCGACAAGGGCTG
GATGGAAGACGGCGAAGGCCGCCGCATCGACTTCCGCAACACCTTGATCATCCTGACCAGCAACGCCGGC
ACCGACCTGATCGCCAGCCTGTGCAAGGACCCGGAACTGATACCCGACCCGGAAGCCATGGCCAAGGCCA
TCCGCGAGCCGTTGTTGAAGGTGTTTCCGCCGGCATTGCTCGGGCGGCTGGTGGCGATTGCGTATTACCC
GCTGAGCAACGACATGCTCGGCCAGATCGTGCGGTTGCAGTTGAATCGCATCAAGAAGCGCATCGAGGAG
CGCTACAAGATTCCGTTCGAGTACGACCACTCGGTGGTGGAGCTGGTGGTATCGCGGTGCACTGAAAGCG
AGTCGGGCGGACGAATGATTGATGCGATTTTGACTAACTCGATGTTGCCGGAGATCAGTCGGCAGTTTCT
CACTCGGGTGATTGAGGGCAAGAAAATCAATCATTCGCGCGCATCGGCCGTGGCGGATGACTTTTTCTAC
GAATTCTGA