SecReT6
Protein ID: 346725012
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2111
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2415850..2417787 [+]
Producthypothetical protein
NoteTssI
UniProt IDG2LT86
KEGG IDxax:XACM_2111
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-73, Aligned region: 23..328
Phage_base_V [PF04717], Evalue: 2.20E-23, Aligned region: 370..463
Protein Sequence: 645 a.a.     [Download]
>gi|346725012|ref|YP_004851681.1| hypothetical protein XACM_2111 [Xanthomonas axonopodis pv. citrumelo F1]
MAHAITLQSPLGKTLRFVRMSAHEALGRPYAFALHGISRDVAIDLRALLGKPMAVKVTSPQGYVRHYHGI
VAEAEQTGFEQIEGLRYATYAFSLVPKLWLLGQRRDCRIYKNKSVPELVRALLADVGCTDVKLRLSASYR
PREYCVQYRESGLDFVNRLMEQEGIYYYFEHSASTHTLVLADSLGGHEAVAPFAQIPYCPPGQKGSRMKD
AITDWSLARSAHSTRVRLDDYDYLKPKASLRVNETPAESSGPALGELEVFDYPGEHLDVAAGRRHAQVRA
EALNVAQAQYQGWTDACGLQVGALFKLRDFPLAEHNQEYLVTSANTELVEVDYVSGGETVAEPFASTFRA
LRSRQPYRSPQTTPRPSIAGLQTAVVDGKTPEDIAVDQHGRVQVNFFWSPPGTPNADCSCPVRVAQAWAG
KRWGAQHIPRVGQEVVVSFLEGNPDRPLIIGSVYNADQMPPYALPEHRTRSGVKSRSLLGGAEDYNEIRF
DDKKGNEELLLHAQRDLRHEVENDHFVTVDRNETAEVKRERSHTVGGNDRLDVGKALRIQAGSEIELVTG
MARLQLKASGEIVLSGTRLTLDGRVSVGIQGGVSVDVSAMANLTLRSNASVLLQSNAVTTARANAALLLQ
SSGPAVLKGTPPIIA
 
Nucleotide Sequence: 1938 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2415850-2417787 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCCCACGCCATTACCCTGCAGTCGCCGCTGGGCAAGACGTTGCGCTTTGTGCGGATGAGTGCGCACG
AGGCGCTGGGGCGCCCGTATGCGTTCGCCTTGCATGGCATCAGCCGCGACGTGGCCATCGACCTGCGCGC
TCTGCTGGGCAAGCCGATGGCGGTCAAGGTCACTTCGCCTCAGGGCTACGTGCGGCACTACCACGGCATT
GTCGCCGAAGCCGAGCAGACCGGTTTCGAGCAGATTGAGGGGCTGCGCTACGCCACCTATGCCTTCTCGC
TGGTGCCCAAGCTGTGGTTGCTCGGGCAGCGCCGCGATTGCCGCATCTACAAGAACAAGAGCGTGCCGGA
GCTGGTGCGCGCATTGCTGGCCGACGTTGGCTGCACCGACGTCAAGTTGCGCCTGAGCGCGAGCTACCGG
CCGCGCGAATATTGCGTGCAGTACCGCGAGAGCGGGCTGGACTTCGTCAACCGGCTGATGGAGCAGGAGG
GCATCTACTACTACTTCGAACACAGCGCCAGCACCCATACGCTGGTGCTGGCCGATAGCCTTGGCGGCCA
CGAGGCGGTGGCGCCGTTCGCGCAGATTCCGTACTGCCCGCCCGGACAGAAGGGCAGCCGGATGAAGGAC
GCAATCACCGACTGGTCGCTGGCGCGCAGCGCGCACAGCACGCGCGTGCGGTTGGACGACTACGACTATC
TCAAGCCCAAGGCGTCGCTGCGGGTGAACGAGACTCCTGCCGAGTCCTCCGGACCGGCGTTGGGTGAGCT
GGAGGTGTTCGACTATCCCGGCGAGCATCTCGATGTCGCCGCCGGCCGCCGCCACGCACAGGTGCGTGCC
GAAGCACTCAACGTGGCGCAGGCGCAGTACCAGGGCTGGACCGATGCCTGCGGTTTGCAGGTCGGTGCGT
TGTTCAAGCTACGCGACTTCCCGCTGGCCGAGCACAACCAGGAATACCTGGTGACCAGCGCGAACACCGA
ATTGGTCGAAGTGGATTATGTGTCCGGTGGCGAAACGGTTGCCGAGCCGTTTGCGTCCACCTTCCGTGCG
CTGCGCAGCCGGCAGCCTTACCGCAGCCCGCAGACCACACCGCGTCCCAGCATCGCCGGATTGCAGACCG
CGGTGGTCGACGGCAAGACGCCCGAGGACATCGCGGTCGACCAGCACGGCCGCGTCCAGGTGAATTTCTT
CTGGAGCCCGCCAGGAACGCCGAACGCCGACTGTTCGTGCCCGGTACGTGTGGCGCAGGCGTGGGCGGGC
AAACGCTGGGGCGCGCAGCACATTCCGCGTGTCGGCCAGGAGGTGGTGGTGAGCTTTCTGGAAGGCAATC
CGGATCGCCCGCTGATCATCGGCAGCGTCTACAACGCCGACCAGATGCCGCCGTATGCACTGCCCGAGCA
CCGCACCCGCAGCGGAGTGAAGAGCCGCAGCTTGTTGGGCGGCGCCGAGGACTACAACGAGATCCGTTTC
GACGACAAGAAGGGCAATGAAGAGCTGCTGCTGCATGCGCAGCGCGATCTGCGCCACGAAGTGGAGAACG
ACCATTTCGTCACTGTCGATCGCAACGAGACCGCGGAGGTCAAACGCGAACGCAGCCACACCGTTGGCGG
CAACGACCGTCTGGACGTGGGCAAGGCGCTGCGCATCCAAGCCGGCAGCGAGATCGAGCTGGTGACCGGC
ATGGCCCGCCTGCAGCTGAAGGCCAGCGGCGAGATCGTGCTCAGCGGCACCCGGCTCACGCTCGATGGAC
GCGTCAGCGTCGGCATCCAGGGCGGCGTCAGTGTCGACGTCAGCGCGATGGCCAACCTGACCCTGCGCTC
GAACGCGTCGGTGCTATTGCAATCGAACGCCGTGACCACCGCGCGCGCCAACGCGGCGCTGCTGTTGCAG
TCGTCCGGTCCGGCCGTGCTCAAGGGCACTCCGCCCATCATCGCCTGA