SecReT6
Protein ID: 346725014
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2113
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2418332..2419717 [+]
ProductFHA-domain-containing protein
NoteFha
UniProt IDG2LT88
KEGG IDxax:XACM_2113
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-14, Aligned region: 34..97
Protein Sequence: 461 a.a.     [Download]
>gi|346725014|ref|YP_004851683.1| FHA-domain-containing protein [Xanthomonas axonopodis pv. citrumelo F1]
MSAASPRLTLTVRDAQAVSGSKQAQVSFAAEGGRIGRDASCDWVLEGEGVSRLHASVRHLDGVYFIEDHS
TNGVLHNGVPLRAGFPVPLHAGDALRIDAFEIDVAVEGAGVTAVPAATQTWNHAEPWTLSPTPPPQPSQQ
PPLERERDVFAELGAASTQPADTDPLALFATSFTLAGSQGDAAAFGLGHAPATADAYRAPVAVSAAAGVV
LPEHWDLTRSEFALPPAIDAIAAVPTPLQPAPVSIVAAAPAPTPAPMPMPASASEVAPASTSAAIPTAAQ
PVVAQSPDAPELPALFAAMTAGLMDVLRARAELKNSLRLPVTLIQRTENNPLKFAATVDEAVARLLAPAG
PGYLTGAAAIDEAMEDIGRHQVALLAGMRAAFEHVFTQFDPARFEADAAGHSALAAWGNRPWRRYAQHYR
ELLGDPDERFRRLFGEEFARAYEQQLARAKTQAQPADGDRA
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2418332-2419717 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGAGCGCGGCGTCGCCCCGACTGACGCTGACGGTGCGCGATGCGCAGGCAGTGTCGGGCAGCAAGCAAG
CGCAGGTCAGCTTCGCGGCAGAAGGCGGGCGCATCGGCCGCGACGCCTCCTGCGACTGGGTGCTGGAAGG
CGAAGGCGTATCGCGCCTGCATGCCAGCGTGCGCCATCTCGATGGCGTGTATTTCATCGAGGATCACAGC
ACCAACGGTGTCCTGCATAACGGCGTGCCGCTGCGTGCCGGCTTCCCGGTGCCGCTGCATGCCGGCGACG
CCTTGCGCATCGATGCCTTCGAGATCGACGTGGCGGTGGAAGGCGCAGGCGTCACCGCTGTTCCGGCGGC
CACGCAGACCTGGAATCACGCCGAGCCGTGGACACTGTCGCCGACGCCGCCACCGCAGCCATCCCAGCAA
CCGCCGCTGGAGCGCGAGCGCGATGTGTTTGCCGAACTTGGGGCAGCGTCGACGCAACCGGCCGACACCG
ACCCGCTGGCCTTGTTCGCCACTTCGTTCACGCTGGCCGGCAGCCAGGGCGATGCGGCGGCGTTCGGGCT
GGGGCATGCGCCGGCAACGGCTGACGCCTACCGTGCCCCCGTGGCCGTGTCGGCTGCCGCTGGCGTCGTG
TTGCCCGAGCATTGGGATCTGACACGCAGCGAATTCGCGCTGCCGCCGGCTATCGATGCAATCGCGGCCG
TGCCAACGCCGTTGCAGCCCGCGCCAGTTTCCATCGTCGCCGCGGCGCCAGCACCGACACCGGCGCCAAT
GCCAATGCCGGCCTCGGCAAGCGAAGTCGCGCCGGCATCGACGTCCGCTGCGATCCCCACCGCAGCGCAG
CCGGTCGTCGCACAGTCGCCGGATGCACCCGAACTGCCTGCGCTGTTCGCCGCCATGACCGCAGGCCTGA
TGGATGTATTGCGCGCACGCGCCGAACTGAAGAACAGCCTGCGCCTGCCGGTCACGCTGATCCAGCGCAC
GGAGAACAATCCGCTCAAGTTCGCCGCCACCGTGGACGAAGCGGTCGCTCGCCTGTTGGCGCCCGCAGGC
CCCGGCTATCTGACCGGTGCGGCTGCGATCGACGAAGCCATGGAGGACATCGGGCGTCACCAGGTGGCCT
TGCTGGCCGGCATGCGTGCGGCCTTCGAGCATGTGTTCACTCAGTTCGATCCGGCGCGCTTCGAGGCCGA
CGCCGCCGGCCATTCCGCGCTCGCCGCCTGGGGCAATCGGCCCTGGCGACGCTACGCGCAGCACTACCGC
GAGCTGCTCGGCGATCCTGACGAGCGCTTCCGCCGCCTGTTCGGCGAAGAGTTCGCCCGCGCCTACGAAC
AACAGCTGGCCCGCGCCAAGACGCAGGCCCAACCCGCAGACGGCGACCGAGCATGA