SecReT6
Protein ID: 346725015
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2114
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2419714..2421051 [+]
Producthypothetical protein
NoteTssK
UniProt IDG2LT89
KEGG IDxax:XACM_2114
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-152, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|346725015|ref|YP_004851684.1| hypothetical protein XACM_2114 [Xanthomonas axonopodis pv. citrumelo F1]
MTPYNKVIWSEGLFLRPQHMQQQERYLERYMELQAGALRPHAWGFSQLELEPELLAIGKLGIRRARGCFP
DGTPFSIPDRDPAPPALDVPANCRDQVVSLALPLRATAQPDSAWPDGDGSRLARYRVGEAEVGDASGSIA
GTVLLEVGVLASRLRLQSEPGEGLVEVPMARIVECRADRRVILDDAFIPTASRIEGAARLSTLLAELLGL
LHQRGQALAERVAGSDRGGVAEIADVLMLQVINRYQPLVAHWASAPLEHPEALYCVLLGMAGELATFTRA
SKRSGPFPPYAHDALQASFEPVVVSLRESLSAVLEQSAIAVPLQQRKYGVWVGMVPDPSLLDSAAFVLAV
KADLRAEDLRKRLPTESKIGPVEKIRDLVNLQLPGVAVSALAMAPRQVPYHAGCAYFELDRQSSLWKTLR
TSGGVALHFGSGFPGLELELWAVRN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2419714-2421051 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGACCCCCTACAACAAGGTGATCTGGAGCGAGGGCCTGTTCCTGCGCCCGCAGCACATGCAACAACAGG
AGCGCTATCTCGAGCGCTACATGGAACTGCAGGCCGGTGCGCTGCGCCCGCATGCGTGGGGATTCAGTCA
ATTGGAGTTGGAGCCGGAACTGCTTGCCATCGGCAAGCTCGGCATCCGCCGCGCCCGCGGTTGCTTTCCT
GACGGCACGCCGTTTTCCATTCCCGATCGCGATCCGGCGCCGCCAGCCTTGGACGTGCCGGCCAACTGCC
GCGACCAGGTGGTGAGCCTGGCGCTGCCGCTGCGCGCAACCGCCCAACCCGATAGCGCCTGGCCTGATGG
CGATGGCAGCCGGCTGGCGCGCTATCGCGTGGGCGAAGCGGAAGTCGGCGATGCCTCCGGCAGCATCGCC
GGCACCGTGCTGCTGGAAGTGGGCGTGCTGGCCAGTCGCCTGCGCCTGCAGTCCGAACCGGGCGAAGGGC
TGGTGGAGGTGCCGATGGCGCGCATCGTCGAATGCCGCGCCGATCGACGGGTGATTCTCGATGACGCCTT
CATCCCGACCGCCAGCCGGATCGAAGGCGCAGCGCGCCTATCTACGCTGCTGGCCGAGTTGCTGGGGCTA
TTGCACCAGCGCGGCCAGGCGCTGGCCGAACGCGTGGCCGGCAGCGACCGGGGTGGCGTGGCGGAAATCG
CCGACGTGCTGATGCTGCAGGTGATCAACCGCTACCAACCGCTGGTGGCGCATTGGGCGAGCGCGCCGTT
GGAGCATCCCGAAGCGCTGTACTGCGTGCTGCTGGGGATGGCTGGCGAACTGGCGACCTTCACCCGTGCC
AGCAAACGCAGCGGGCCATTTCCGCCGTATGCACACGATGCGTTGCAGGCGAGCTTCGAGCCGGTGGTGG
TGTCCTTGCGCGAAAGCCTGAGCGCGGTGCTCGAACAGTCGGCCATTGCCGTGCCCTTGCAGCAACGCAA
GTACGGCGTATGGGTGGGCATGGTGCCCGATCCTTCCTTGCTGGACTCGGCGGCGTTCGTGCTGGCGGTC
AAGGCGGATCTGCGCGCCGAGGACCTGCGTAAGCGGCTGCCCACCGAGTCGAAGATCGGCCCGGTGGAGA
AGATCCGCGACCTGGTGAACCTGCAACTGCCCGGCGTGGCCGTGAGCGCGCTGGCGATGGCACCGCGGCA
GGTGCCGTATCACGCCGGTTGCGCCTACTTCGAACTCGATCGGCAATCGTCGCTGTGGAAGACGCTGCGC
ACCTCCGGTGGCGTGGCGCTGCATTTCGGCAGTGGTTTTCCCGGCCTGGAACTGGAGCTGTGGGCGGTGA
GGAATTGA