SecReT6
Protein ID: 346725016
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2115
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2421053..2422369 [+]
Producthypothetical protein
NoteTssL
UniProt IDG2LT90
KEGG IDxax:XACM_2115
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-66, Aligned region: 57..262
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 200..237
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 329..419
Protein Sequence: 438 a.a.     [Download]
>gi|346725016|ref|YP_004851685.1| hypothetical protein XACM_2115 [Xanthomonas axonopodis pv. citrumelo F1]
MSNTVDQHDDDATVVRSATPAPRAAAATPARQATTRTVPPPDLDAAMRAAPGAMQGNAVVRAATPLLLLA
VQLRHSTQTPDIATLREHCSTRLQRFEQELRQQGIDDKTGIAARYVLCTLLDEAVLAAPWGEGSGWSQRT
LLVTFHGETYGGAKVFDLLDRLARDPARHLDLLELLYLALALGFGGRYRVEQGGRARLADRQAELYQLIQ
RQRLPAPAELSPNWQGAQAPLLRNTAATPLWIATLASLCIVLLAFVWLHARLNALTAPISAQLARIGLER
VTLPIPAAATPATAAALAPLLAAEQRAGWLTVQTEGDGRSTVRLASASMFPSGSAELDADQTRLLERVAA
ALEQVPGRVVVVGHTDDQPVRSLRFKDNFALSARRAQSVGAVLAAGLRDPRRVQTSGAGDSQPIALPPQL
PGNRARNRRVEILLIPET
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2421053-2422369 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGAGCAATACGGTCGACCAACACGACGACGATGCCACCGTGGTCCGCAGCGCGACGCCGGCGCCGCGGG
CCGCTGCCGCCACGCCGGCTCGCCAGGCGACGACGCGCACCGTGCCACCGCCCGACCTGGATGCCGCAAT
GCGTGCGGCGCCGGGCGCGATGCAGGGCAATGCGGTGGTGCGCGCCGCCACGCCGCTGCTGTTGCTGGCG
GTGCAGTTGCGACACTCCACCCAGACGCCGGACATCGCCACCTTGCGCGAACACTGCAGCACGCGCCTGC
AGCGCTTCGAGCAGGAGCTGCGGCAACAGGGCATCGACGACAAGACCGGCATCGCCGCGCGCTATGTGCT
GTGCACGCTGCTGGACGAAGCCGTGCTGGCCGCGCCGTGGGGCGAGGGCAGCGGCTGGTCGCAGCGCACC
TTGCTGGTGACCTTCCACGGCGAGACCTATGGCGGCGCCAAGGTCTTCGACCTGCTCGATCGGCTGGCGC
GCGATCCGGCGCGGCACCTGGACCTGCTGGAGCTGCTGTATCTGGCCTTGGCGCTCGGCTTTGGCGGTCG
CTATCGGGTGGAGCAGGGCGGGCGCGCGCGGCTGGCCGATCGCCAGGCCGAGCTGTACCAACTCATCCAG
CGCCAGCGCCTGCCGGCGCCTGCCGAGCTGTCGCCCAACTGGCAAGGCGCGCAGGCACCGTTGCTGCGCA
ATACGGCGGCCACGCCGCTGTGGATCGCGACGCTGGCCTCGCTGTGCATCGTGCTGCTGGCGTTCGTGTG
GTTGCATGCACGCCTCAATGCGCTGACCGCGCCGATCAGCGCGCAGCTGGCGCGCATCGGCCTGGAGCGG
GTGACGTTGCCGATCCCGGCGGCGGCCACACCCGCAACCGCCGCAGCGCTTGCACCGCTGCTGGCCGCCG
AGCAACGCGCAGGATGGCTGACCGTCCAGACCGAGGGCGATGGTCGCAGCACGGTGCGGCTGGCCAGTGC
GTCCATGTTCCCCAGCGGGAGCGCGGAGTTGGATGCCGATCAGACCCGCCTGCTCGAACGCGTTGCTGCG
GCGCTGGAACAGGTGCCGGGGCGGGTGGTGGTGGTGGGACATACCGACGACCAACCGGTGCGCTCGCTGC
GCTTCAAGGACAACTTCGCCTTGTCGGCGCGCCGCGCCCAGAGCGTGGGCGCCGTGTTGGCGGCCGGCTT
GCGCGACCCGCGCCGCGTCCAGACCAGCGGCGCGGGCGATTCCCAGCCCATTGCGTTACCGCCGCAGCTG
CCCGGCAACCGTGCGCGCAATCGGCGCGTCGAAATCCTGTTGATTCCCGAGACCTGA