SecReT6
Protein ID: 346725022
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2121
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2430601..2431629 [-]
Producthypothetical protein
NoteTssA
UniProt IDG2LT96
KEGG IDxax:XACM_2121
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.50E-20, Aligned region: 55..113
Protein Sequence: 342 a.a.     [Download]
>gi|346725022|ref|YP_004851691.1| hypothetical protein XACM_2121 [Xanthomonas axonopodis pv. citrumelo F1]
MQIDSEQLLQPVDAQAPSGPNLEYTPEFQSLEELARPRQERALGAGVLVPEAPEWRQVADSAEHLLLRSK
DLRLGILLSIARLHQDGLVGWSSGVSLLRHLLERFWDDVHPGLDADEDNDPTERVNAIAALADSERTLTQ
LRNVRLFKGLHPGHFSLRDLRIVQGTLKRAADDPSEAPEPAAIDACLRDCPLEALLELDAALAAAQDDIA
AMAGLFAERTPGYGPELAPLTHDLGELRAFLRPYVAERSGSTADQTEHAASGTDDANASAPRAHAVEHPD
DVRRMLDQLCDYYARREPSSPVPLLLRRAQRLVGLDFAALMRDLAPRGIDELQVVSGQDHSD
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c2431629-2430601 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGCAGATCGACAGCGAACAGCTACTGCAGCCGGTGGACGCACAGGCGCCGTCCGGTCCGAACCTGGAAT
ACACCCCGGAGTTCCAGAGCCTGGAAGAACTGGCACGCCCGCGTCAGGAACGCGCACTGGGCGCGGGCGT
GCTGGTGCCCGAGGCGCCGGAGTGGCGTCAGGTCGCCGACAGCGCCGAGCACTTGTTGCTGCGCTCCAAG
GACTTGCGACTGGGCATCTTGCTGAGCATTGCCCGCCTGCACCAGGACGGCCTGGTGGGCTGGTCCAGCG
GCGTCAGCCTGCTCCGGCACCTGCTAGAGCGGTTCTGGGACGACGTCCATCCTGGTCTGGATGCCGATGA
GGACAACGACCCGACCGAACGCGTCAACGCCATCGCGGCGCTGGCCGACAGCGAGCGCACGTTGACGCAG
CTGCGCAACGTCCGCCTGTTCAAGGGACTGCATCCTGGGCACTTTTCGCTGCGCGATCTGCGCATCGTGC
AGGGCACGCTCAAGCGCGCTGCGGACGACCCCAGCGAAGCGCCAGAGCCGGCCGCCATCGATGCCTGCCT
GCGCGACTGTCCACTGGAGGCGCTGCTGGAGCTGGATGCGGCCCTGGCCGCTGCGCAGGACGATATCGCC
GCGATGGCCGGCCTGTTCGCCGAGCGCACCCCCGGATACGGCCCGGAGCTGGCGCCGTTGACGCACGACC
TGGGCGAGTTGCGCGCGTTCCTGCGGCCTTATGTCGCCGAGCGTTCCGGCTCCACGGCCGACCAGACCGA
GCATGCAGCATCCGGCACCGATGATGCCAATGCATCTGCACCGCGGGCGCACGCCGTGGAGCATCCGGAC
GACGTTCGCCGCATGCTCGATCAGCTGTGCGATTACTACGCGCGGCGCGAGCCCTCCAGCCCGGTGCCGT
TGTTGTTGCGGCGCGCGCAACGGCTGGTCGGCCTGGATTTTGCCGCGCTGATGCGCGACCTGGCGCCACG
CGGGATCGACGAGCTGCAGGTGGTGTCGGGCCAGGACCATTCCGATTAG