SecReT6
Protein ID: 346726852
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_3987
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4612428..4613684 [-]
Producthypothetical protein
NoteTssL
UniProt IDG2LYM0
KEGG IDxax:XACM_3987
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.60E-70, Aligned region: 39..243
OmpA [PF00691], Evalue: 3.80E-11, Aligned region: 309..397
Protein Sequence: 418 a.a.     [Download]
>gi|346726852|ref|YP_004853521.1| hypothetical protein XACM_3987 [Xanthomonas axonopodis pv. citrumelo F1]
MSRPVADLAPAYAAPLPAAEGGVPSEDTDISELLGRSVNPLVQAATPLLLLAVQLRHSAQSPDVARLREQ
VMAQVRRFEQRARDGGAPVEAVTAARYVLCALLDEAVLNAPWGERSGWSQKTLLVTFHSESYGGAKFFQI
LERLCADVPRHLDLIELMYLCLALGFVGRYQIESGGMVTLAAIQDDVYRRIRAARGPAPDSLAPRWRGVE
DRRRLGRYLPVWAAALLGVSVVVVAFVWLQARLNSLSAPISAQAAQWGIAPATPPDAAPVPPPPVRLKQL
LSAQERAGLLRVDEQADGQTRVRLSSAAMFASGGVEVEPQQRGLIAQIAAAIEQLPGRVIVVGHTDDVPV
RSLRFQDNYALSAARAQALAKVLQAQLSTPGRVDAIGAGDSQPIARPVQLPANRARNRRVEILFQPGE
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4613684-4612428 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGAGCCGACCTGTTGCCGATCTGGCGCCTGCCTACGCCGCACCGCTGCCGGCCGCAGAGGGCGGCGTGC
CCAGCGAAGATACCGACATCAGCGAACTGCTGGGCCGCAGCGTCAACCCGTTGGTGCAGGCCGCCACGCC
GCTGCTGCTGTTGGCGGTGCAGTTGCGCCACAGTGCGCAATCGCCCGATGTGGCCCGCCTGCGCGAGCAG
GTGATGGCGCAGGTGCGCCGCTTCGAACAACGTGCACGCGATGGCGGCGCGCCGGTGGAGGCGGTCACCG
CCGCGCGCTACGTGTTGTGCGCGCTGCTGGACGAAGCGGTGCTCAATGCGCCGTGGGGCGAGCGCAGCGG
CTGGTCGCAGAAGACCTTGCTGGTCACCTTCCACAGCGAATCGTACGGCGGCGCCAAGTTCTTCCAGATC
CTGGAGCGCTTGTGCGCCGATGTGCCACGGCATCTGGACTTGATCGAGCTGATGTACCTGTGCCTGGCGC
TGGGGTTCGTCGGCCGCTACCAGATCGAGTCCGGCGGCATGGTGACGCTGGCGGCCATCCAGGACGATGT
CTATCGCCGCATCCGTGCGGCGCGCGGCCCGGCGCCGGACAGCCTGGCCCCGCGTTGGCGCGGGGTGGAA
GACCGCCGCCGGCTGGGCCGCTATCTGCCGGTGTGGGCGGCTGCGTTGCTGGGGGTGAGCGTGGTGGTGG
TGGCGTTCGTGTGGTTGCAGGCGCGTTTGAACAGCCTGTCCGCACCGATCAGTGCGCAGGCTGCCCAATG
GGGCATTGCGCCGGCCACGCCGCCGGACGCTGCGCCCGTGCCGCCGCCGCCGGTGCGGCTCAAGCAGTTG
CTCTCCGCGCAGGAACGCGCCGGCCTGCTGCGCGTGGACGAACAGGCCGACGGGCAGACGCGCGTGCGCC
TGAGCAGCGCGGCGATGTTCGCCTCCGGCGGGGTGGAGGTGGAGCCGCAGCAGCGCGGCTTGATCGCGCA
GATTGCAGCGGCCATCGAGCAATTGCCAGGGCGGGTGATCGTGGTCGGGCACACCGATGACGTGCCGGTG
CGCTCGCTGCGCTTCCAGGACAACTACGCCTTGTCGGCCGCACGTGCGCAGGCGCTTGCGAAGGTGTTGC
AGGCGCAGCTGAGTACGCCGGGGCGGGTGGACGCCATCGGCGCTGGCGATTCGCAACCGATCGCACGGCC
AGTGCAATTGCCGGCCAACCGCGCGCGCAATCGCCGCGTGGAGATCCTGTTCCAGCCTGGGGAATGA