SecReT6
Protein ID: 346726853
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_3988
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4613687..4615021 [-]
Producthypothetical protein
NoteTssK
UniProt IDG2LYM1
KEGG IDxax:XACM_3988
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-153, Aligned region: 18..443
Protein Sequence: 444 a.a.     [Download]
>gi|346726853|ref|YP_004853522.1| hypothetical protein XACM_3988 [Xanthomonas axonopodis pv. citrumelo F1]
MQNNKVVWSEGLFLRPQHLQQQERYLERYVDLRAARLRPHAWGVSELEWETDLLAVGKLGLRRARGVFAD
GTPFAMPCDDPLPVALEVEPTCRDQIVYLTVPLRVPAQPELGRPESPADQLFRYRVRETESNDASGSTSE
AVLMEVGGLSTRLLPHSQPLEGLDRIAVARIIETRADRQVVLDPHFIPSAMVCQAAPRLTTFLTELLGLL
HQRGEALASRVTLTDRGGAADIADFLLLQLVNRWQPQMAHWAAAPLAHPEELFRALVALAGELSTFTAAG
KRPPAWPAYRHDSQQDSFEPVIGALRSSLSAVLEQTATPLPIQARKFGVWVAMVPDPGLLDSAAFVLAAK
ADMPSEELRRQLPAHAKIGPVEQIRDLVNLQLPGIVATPMPVAPRQIPYHAGYLYFEFDKSAALWRTLKT
SGGIAFHFGSEFAGLDLQLWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4615021-4613687 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGCAGAACAACAAGGTCGTGTGGAGCGAAGGGCTGTTCCTGCGCCCGCAGCATCTGCAGCAGCAGGAGC
GCTACCTGGAGCGCTACGTCGACCTGCGTGCGGCGCGGTTGCGGCCGCATGCCTGGGGCGTGAGCGAGCT
GGAATGGGAGACCGATCTGCTGGCGGTCGGCAAGCTGGGCCTGCGTCGTGCGCGTGGCGTGTTCGCCGAT
GGCACGCCCTTCGCCATGCCTTGCGACGACCCGCTGCCGGTGGCGCTGGAGGTCGAGCCCACTTGCCGCG
ACCAGATCGTCTATCTCACCGTGCCGCTGCGGGTGCCGGCGCAACCCGAACTGGGGCGCCCGGAATCGCC
GGCCGATCAGCTGTTTCGCTACCGCGTGCGCGAGACCGAGAGCAACGACGCCTCCGGTAGCACCAGCGAA
GCGGTGTTGATGGAAGTCGGCGGGTTGAGCACGCGGTTGCTGCCGCACTCGCAGCCGTTGGAAGGGCTGG
ACCGCATCGCGGTGGCGCGCATCATCGAGACGCGCGCCGACCGCCAGGTGGTGCTGGACCCGCATTTCAT
TCCCAGCGCGATGGTGTGCCAGGCGGCGCCGCGCTTGACCACGTTTCTCACCGAATTGCTCGGCCTGTTG
CATCAGCGCGGGGAGGCGCTGGCATCGCGGGTGACGCTGACCGATCGCGGCGGTGCTGCCGATATCGCAG
ACTTTCTGTTGCTGCAGCTGGTCAACCGTTGGCAGCCGCAGATGGCGCATTGGGCCGCCGCGCCATTGGC
GCATCCGGAAGAGCTGTTCCGTGCCCTGGTGGCGCTGGCCGGCGAATTGAGCACGTTCACCGCTGCCGGC
AAGCGCCCCCCTGCATGGCCCGCCTATCGGCACGATTCGCAGCAGGACAGTTTCGAGCCGGTGATCGGCG
CCCTGCGCAGCAGCCTGAGCGCAGTGCTGGAACAGACCGCCACGCCGCTGCCGATCCAGGCGCGCAAGTT
CGGCGTGTGGGTGGCGATGGTGCCGGACCCGGGCCTGCTCGACAGCGCAGCGTTCGTGCTCGCGGCCAAG
GCCGACATGCCCAGCGAAGAGTTGCGCCGGCAATTGCCCGCGCACGCCAAGATCGGGCCGGTGGAGCAGA
TTCGCGATCTGGTCAATCTGCAGTTGCCCGGCATCGTGGCCACGCCCATGCCGGTGGCGCCGCGACAGAT
TCCGTATCACGCCGGCTATCTGTATTTCGAATTCGACAAGAGCGCAGCGTTGTGGCGAACGCTGAAGACC
TCCGGCGGCATCGCATTCCACTTCGGCAGCGAATTCGCCGGGCTGGACCTGCAACTGTGGGCGATCCGGA
GCTGA