SecReT6
Protein ID: 346726856
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_3991
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4617604..4618935 [-]
ProductFHA-domain-containing protein
NoteFha
UniProt IDG2LYM4
KEGG IDxax:XACM_3991
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-15, Aligned region: 32..95
Protein Sequence: 443 a.a.     [Download]
>gi|346726856|ref|YP_004853525.1| FHA-domain-containing protein [Xanthomonas axonopodis pv. citrumelo F1]
MSSSQLILTVSGAQAAQFGASAQKRFAGTGGSIGRSDESDWVLAAPGVSRTHAVVRFLNGMYFIEDRSTN
GMSLNGTALTRADPSALSDGDRLQLDSFEIQVQVQALAAASPATPVFDPLPDAMDDRTQVAPPPSTLRAP
SATAGFDLLEFGTPPAARPAVDAVLDDLLLSGAPRELDPLRLLDPLPAPARDASPSAWNQSNARHDHFRP
PASPDARATLPENWDMTLGDFAPTAPLPAVSPMAAPVVSPFTSPAAPVAAAASAATTVPPELDRIFAIVV
DGVMDVLRARAEIKNTFRLPVTVIQRSENNPLKFAATAEDALQKLLAPPSASFLSGVPAFEDAFDDIRCH
QMAMLAGMRAAFDAMLFHFSPDRLEQEADAGGKRLSFGGKGRYWERYRDNFEQLRSDPDECFRRLFGDEF
ARAYEAQLARLKSARRQPAGRGT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4618935-4617604 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
GTGTCCAGTTCGCAGTTGATTCTCACCGTCAGCGGCGCGCAGGCCGCGCAGTTCGGTGCCAGCGCGCAGA
AGCGCTTTGCCGGCACCGGCGGCAGCATCGGCCGCTCCGACGAAAGCGATTGGGTCCTGGCCGCGCCCGG
TGTCTCGCGCACGCATGCGGTGGTGCGCTTCCTCAACGGGATGTATTTCATCGAAGACCGCAGCACCAAC
GGCATGTCGCTCAACGGCACTGCGCTGACGCGTGCGGACCCGTCCGCGCTCAGCGATGGCGACCGCCTGC
AGCTGGACAGCTTCGAGATCCAGGTGCAGGTGCAGGCGTTGGCTGCAGCATCGCCGGCAACACCGGTGTT
TGACCCGCTGCCAGATGCGATGGACGACCGCACCCAGGTTGCGCCACCGCCGTCGACGCTGCGTGCCCCC
TCCGCCACAGCGGGCTTCGATCTGCTGGAGTTCGGCACGCCGCCTGCGGCGCGGCCTGCGGTGGACGCAG
TGTTGGACGATCTGCTGCTGAGCGGCGCACCCCGCGAGCTGGATCCGTTGCGCCTGCTCGACCCGTTGCC
TGCGCCGGCGCGCGATGCCAGCCCCAGCGCGTGGAATCAGAGCAACGCCCGCCACGACCATTTCCGTCCG
CCGGCCAGTCCCGATGCGCGTGCCACCTTGCCGGAAAACTGGGACATGACGCTTGGCGATTTTGCGCCAA
CCGCGCCATTGCCTGCGGTATCGCCCATGGCCGCGCCGGTGGTTTCGCCATTCACGTCGCCGGCGGCGCC
GGTTGCAGCCGCAGCATCGGCGGCAACGACGGTGCCGCCGGAGCTGGATCGCATCTTCGCCATCGTGGTC
GACGGCGTCATGGACGTGCTGCGTGCACGCGCGGAGATCAAGAACACCTTCCGGCTGCCGGTCACGGTGA
TCCAGCGCTCGGAGAACAATCCGCTCAAGTTCGCCGCCACCGCCGAAGATGCGCTGCAGAAGTTGCTCGC
ACCGCCAAGCGCGTCGTTTCTGTCCGGCGTGCCAGCGTTCGAAGATGCCTTCGACGATATCCGCTGCCAT
CAGATGGCGATGCTGGCCGGCATGCGCGCAGCCTTCGACGCCATGCTGTTCCACTTCAGCCCGGACCGCC
TGGAGCAGGAAGCCGACGCCGGCGGCAAGCGCCTGAGTTTCGGTGGCAAGGGGCGTTACTGGGAGCGTTA
CCGCGACAACTTCGAGCAGCTACGCAGCGACCCGGACGAATGCTTCCGTCGCCTGTTCGGCGATGAGTTC
GCGCGTGCCTACGAAGCGCAACTGGCGCGCCTGAAATCGGCACGGCGGCAGCCGGCGGGGCGCGGGACCT
AG