SecReT6
Protein ID: 346726858
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_3993
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4619799..4621766 [-]
Producthypothetical protein
NoteTssI
UniProt IDG2LYM6
KEGG IDxax:XACM_3993
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-71, Aligned region: 24..329
Phage_base_V [PF04717], Evalue: 8.00E-24, Aligned region: 50..64
Phage_base_V [PF04717], Evalue: 8.00E-24, Aligned region: 367..459
Protein Sequence: 655 a.a.     [Download]
>gi|346726858|ref|YP_004853527.1| hypothetical protein XACM_3993 [Xanthomonas axonopodis pv. citrumelo F1]
MPRTITLHSDLGERLLLHRMQASEALGQLFDYRIDALCTELQPNLRDLLGTPVAVQLADGEGEQRWYHGM
VASCAHNGYAVVDALDYAVLELQVVPKPWLLTQRRDCRIYQDMSVPEIVTSVLGEIGYGDVQQQLSAQYA
KRSYCVQYREDDFSFISRLLEREGIYYYFTHTRSAHTLVLADALGAHATKNGVDSLPYVPPGTDDRRLMR
SVVSHWRSARGVHSSQHGSTDYDPLQPRASLAADADAGGEQLHTVDGLIAFDYPGAHTVQADGRRYMQVR
TEAHNVQRASHAATTNACGLMVGALFRLRGFPRAELNQEYLVLSAHTTLAAPEHGSGEPPFSSSVQVMES
RLPFRSLQRTATPTIAGLQTAVVTGDTDEDIAVDAHGRVQVTFHWATAARPHAAPSCWVRVASMWAGKGW
GAMSLPRVGQEVVVSFLEGDPDRPLIVGSVYNGDHAPPFSLPDNKTQSGVRSRSLLGGAADFNELRFDDK
AGAEELYLRAQRDLREEVQHDHTSTIDNDRVLAVKHDRRARIDNNDSVEVGKKLLLKAGEEIELVTGSAR
LVMKHNGEIVLSGIKILVDASSEAKITSTAIKLLANAQLQAKSPATEVAGDATLKLTSGGMLSAEAGASA
TLKGPLVSIKADALVQVGGGLIMIG
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4621766-4619799 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGCCGCGCACCATCACGCTGCACTCCGACCTTGGCGAGCGCCTGCTGCTGCATCGCATGCAGGCCAGCG
AGGCGTTGGGGCAGCTGTTCGACTACCGCATCGATGCGTTGTGCACCGAACTGCAGCCCAACCTGCGTGA
TCTGCTTGGCACGCCAGTGGCGGTGCAGCTGGCCGATGGCGAGGGCGAACAGCGCTGGTATCACGGCATG
GTGGCCAGTTGCGCGCACAACGGCTACGCCGTGGTCGATGCGCTCGATTACGCCGTGCTTGAACTGCAGG
TGGTGCCCAAACCCTGGCTGCTGACTCAGCGCCGCGATTGCCGCATCTATCAGGACATGAGCGTGCCGGA
GATCGTCACCAGCGTGCTGGGCGAGATCGGCTACGGCGATGTGCAGCAGCAGTTGAGCGCGCAGTACGCC
AAGCGCAGCTACTGCGTGCAATACCGCGAGGACGATTTCAGCTTCATCAGCCGGCTGCTGGAACGCGAAG
GCATCTACTACTACTTCACCCATACCCGCAGTGCGCATACGTTGGTGCTGGCCGATGCGCTGGGTGCGCA
TGCAACGAAAAACGGCGTGGACAGCCTGCCCTATGTGCCGCCGGGAACCGATGACCGGCGCCTGATGCGC
TCGGTGGTGAGCCATTGGCGCAGTGCGCGCGGCGTGCATTCCAGCCAGCATGGCAGCACCGACTACGACC
CGCTGCAGCCGCGTGCATCGCTGGCCGCCGATGCCGATGCCGGCGGCGAACAGTTGCACACCGTCGATGG
TCTGATCGCCTTCGACTACCCCGGCGCGCATACCGTGCAGGCCGACGGTCGTCGCTACATGCAGGTACGC
ACCGAGGCGCACAACGTGCAGCGCGCCAGCCATGCAGCCACCACCAATGCCTGCGGACTGATGGTCGGTG
CCTTGTTTCGCTTGCGCGGGTTTCCGCGCGCCGAACTCAATCAGGAATATCTGGTGCTGTCGGCGCACAC
CACGCTGGCCGCGCCCGAACACGGCAGCGGCGAGCCGCCGTTTTCCAGCAGCGTGCAGGTGATGGAAAGC
CGGCTGCCGTTCCGTAGCCTGCAACGCACCGCAACGCCGACCATTGCCGGCCTGCAGACGGCGGTGGTGA
CCGGCGACACCGACGAGGACATTGCGGTGGATGCGCATGGCCGCGTGCAGGTGACCTTTCACTGGGCCAC
TGCGGCACGCCCGCATGCCGCGCCGTCGTGCTGGGTGCGTGTGGCTTCGATGTGGGCGGGCAAGGGCTGG
GGCGCAATGAGCCTGCCGCGCGTGGGGCAGGAAGTGGTGGTGAGCTTTCTGGAAGGCGACCCGGACCGCC
CGTTGATCGTGGGCAGCGTCTACAACGGCGACCATGCGCCGCCGTTTTCCTTGCCCGATAACAAGACCCA
AAGCGGCGTGCGCAGCCGCAGCCTGCTGGGCGGCGCTGCCGATTTCAACGAGTTGCGTTTCGACGACAAG
GCCGGCGCGGAAGAACTCTACCTGCGCGCGCAGCGCGATTTGCGCGAAGAGGTGCAGCACGACCACACCA
GTACCATCGACAACGATCGGGTCCTGGCGGTCAAGCACGACCGTCGTGCGCGGATCGACAACAACGACAG
CGTGGAGGTCGGCAAGAAGCTGCTGCTGAAAGCCGGCGAAGAGATCGAATTGGTGACCGGCAGCGCGCGG
CTGGTGATGAAACACAACGGCGAGATCGTGTTGAGCGGCATCAAGATCCTGGTCGATGCCAGCTCGGAGG
CCAAGATCACCTCCACCGCCATCAAGCTGTTGGCCAATGCACAGCTGCAGGCCAAATCGCCGGCCACCGA
GGTGGCTGGCGATGCCACGCTCAAACTGACCTCCGGCGGCATGCTCAGCGCCGAGGCCGGTGCCTCGGCC
ACGCTCAAGGGCCCGTTGGTCAGCATCAAGGCCGACGCCTTGGTGCAGGTCGGCGGCGGCCTGATCATGA
TCGGATGA