SecReT6
Protein ID: 346726873
SecReT6 ID461
T6SS typei3
Gene symbolclpB
Locus tagXACM_4008
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4639620..4642382 [-]
ProductClpB protein
NoteTssH
UniProt IDG2LYP1
KEGG IDxax:XACM_4008
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 235..256
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 652..818
AAA [PF00004], Evalue: 9.40E-18, Aligned region: 236..348
AAA [PF00004], Evalue: 9.40E-18, Aligned region: 658..742
ClpB_D2-small [PF10431], Evalue: 3.10E-16, Aligned region: 825..899
AAA_5 [PF07728], Evalue: 3.90E-12, Aligned region: 236..256
AAA_5 [PF07728], Evalue: 3.90E-12, Aligned region: 366..403
AAA_5 [PF07728], Evalue: 3.90E-12, Aligned region: 657..775
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 40..76
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 213..258
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 280..314
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 473..473
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 628..700
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 722..743
Sigma54_activat [PF00158], Evalue: 4.50E-07, Aligned region: 214..258
Sigma54_activat [PF00158], Evalue: 4.50E-07, Aligned region: 656..770
Zeta_toxin [PF06414], Evalue: 7.00E-06, Aligned region: 235..258
Zeta_toxin [PF06414], Evalue: 7.00E-06, Aligned region: 656..697
Zeta_toxin [PF06414], Evalue: 7.00E-06, Aligned region: 828..864
AAA_22 [PF13401], Evalue: 9.20E-06, Aligned region: 63..97
AAA_22 [PF13401], Evalue: 9.20E-06, Aligned region: 235..270
AAA_22 [PF13401], Evalue: 9.20E-06, Aligned region: 368..402
AAA_22 [PF13401], Evalue: 9.20E-06, Aligned region: 655..680
AAA_22 [PF13401], Evalue: 9.20E-06, Aligned region: 719..741
AAA_14 [PF13173], Evalue: 2.90E-05, Aligned region: 236..304
AAA_14 [PF13173], Evalue: 2.90E-05, Aligned region: 342..402
AAA_14 [PF13173], Evalue: 2.90E-05, Aligned region: 656..767
AAA_14 [PF13173], Evalue: 2.90E-05, Aligned region: 875..898
NACHT [PF05729], Evalue: 6.90E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 6.90E-05, Aligned region: 657..684
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 236..260
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 657..695
AAA_25 [PF13481], Evalue: 0.00014, Aligned region: 231..312
AAA_25 [PF13481], Evalue: 0.00014, Aligned region: 362..407
AAA_25 [PF13481], Evalue: 0.00014, Aligned region: 655..682
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 233..259
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 655..679
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 214..256
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 288..385
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 656..698
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 723..739
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 229..257
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 657..676
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 236..256
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 658..688
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 840..852
AAA_29 [PF13555], Evalue: 0.0049, Aligned region: 228..251
AAA_29 [PF13555], Evalue: 0.0049, Aligned region: 655..682
DUF815 [PF05673], Evalue: 0.0072, Aligned region: 226..311
DUF815 [PF05673], Evalue: 0.0072, Aligned region: 656..695
Clp_N [PF02861], Evalue: 0.0082, Aligned region: 29..75
Protein Sequence: 920 a.a.     [Download]
>gi|346726873|ref|YP_004853542.1| ClpB protein [Xanthomonas axonopodis pv. citrumelo F1]
MAEISRSALFGKLNPLAYRGIESATVFCKLRGNPYVELVHWLHQLLQLQDSDLHRIIKHFQLNPSTLARD
VTSALDALPRGSTAVTDLSANVEEAVERGWVYASLSFGEAQVRTGYLVVGILSVRGLRNALLAISKEFDK
LKPAVLSEDFARIVAGSPEDGLLPSDGFSLGQTAAPGEASGAIAPAALGKQEALKKFTTDLTAQAREGKL
DPIIGRDDEIRQVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGDVPPALKDVQLRTLDVGLLQA
GASMKGEFEQRLRAVIDEVQASPKPIILFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTVGATTFA
EYKKYIEKDPALTRRFQAVQVDEPDEAKAVRMMRGVASMLEQHHRVQILDEALEAAVKLSHRYIPARQLP
DKSVSLLDTACARVAVSLHATPAEVDDSRRRIESLETEHAIIERERAIGIVVDERAAACAGLLESEHGRL
RDLEQRWFAEKALVDELLSLRAQLRSSNSSMEGTGSALEEEADTDADAAVAQSASGDTAVLDAPVQVDRD
TLLARLQLVQAELAALQGESPLILPTVDYQAVAAVVADWTGIPVGRMARNEIDTVLRLPDLLAKRVIGQD
HAMEMIAKRIQTSRAGLDNPDKPIGVFLLAGTSGVGKTETALALAETLYGGEQNLITINMSEYQEAHTVS
SLKGAPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHELFFQVFDKGWMEDGEGRRIDFRNTLI
ILTSNAGTDLIASLCKDPELMPDPDRMAKAIREPLLKVFPPALLGRLVAIPYYPLSNDMLGQIVRLQLNR
IKKRIEERYKIPLEYDDSVVELVVSRCTESESGGRMIDAILTNSMLPDLSKEFLSGLAASSKFQRIRVAA
DKSEFEYFFG
 
Nucleotide Sequence: 2763 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4642382-4639620 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCCGAGATCTCCCGCAGTGCCCTGTTCGGCAAGCTCAATCCGCTGGCCTACCGCGGTATCGAGAGCG
CCACCGTGTTCTGCAAGCTGCGCGGCAACCCGTATGTGGAGCTGGTGCATTGGCTGCATCAGTTGCTGCA
GCTGCAGGACTCGGACCTGCACCGCATCATCAAACACTTTCAGCTCAACCCCTCCACGCTGGCGCGTGAT
GTCACGTCGGCCCTGGACGCCTTGCCGCGCGGTTCCACTGCCGTCACCGACCTGTCGGCCAATGTCGAAG
AAGCGGTGGAGCGCGGTTGGGTGTATGCCTCACTGAGTTTTGGTGAAGCGCAGGTGCGCACCGGCTATCT
GGTGGTTGGCATTCTGAGCGTGCGCGGTTTGCGTAATGCATTACTGGCGATCTCCAAGGAGTTCGACAAG
CTCAAGCCCGCGGTACTCAGCGAAGACTTTGCGCGGATCGTGGCCGGCTCCCCGGAAGATGGTTTGCTGC
CCAGCGATGGTTTCTCACTCGGTCAGACCGCTGCACCTGGGGAGGCTAGCGGCGCCATCGCGCCGGCCGC
ACTGGGAAAGCAGGAAGCACTGAAGAAATTCACCACCGACCTCACCGCACAGGCACGCGAGGGCAAGCTG
GACCCGATCATCGGCCGCGACGACGAGATCCGCCAGGTGGTCGATATCCTGATGCGCCGCCGCCAGAACA
ACCCGATCCTGGTCGGCGAGGCCGGTGTCGGCAAGACCGCGGTGGTGGAAGGCTTCGCACAACGCATCGC
GCGCGGCGATGTGCCGCCCGCGTTGAAGGATGTGCAGCTGCGCACGCTGGATGTGGGCCTGCTGCAGGCC
GGCGCCAGCATGAAGGGCGAATTCGAGCAACGCCTGCGCGCAGTCATCGACGAAGTGCAGGCCAGCCCCA
AGCCGATCATTTTGTTTGTCGACGAAACCCACACCCTGGTCGGCGCCGGTGGCGCGGCCGGTACCGGCGA
TGCGGCCAACCTGCTCAAGCCCGCACTGGCGCGTGGCACCTTGCGCACCGTGGGGGCGACCACGTTTGCC
GAGTACAAGAAGTACATCGAAAAAGACCCCGCGCTGACGCGGCGCTTCCAGGCCGTGCAGGTGGACGAGC
CGGACGAAGCCAAGGCAGTGCGCATGATGCGCGGCGTCGCTTCGATGCTGGAACAGCACCACCGTGTGCA
GATCCTGGACGAAGCGCTGGAAGCGGCAGTCAAGCTCAGTCACCGCTATATCCCCGCGCGGCAACTACCT
GACAAGTCGGTGAGCCTGCTCGATACCGCCTGCGCCCGCGTGGCGGTGAGCCTGCACGCTACGCCTGCGG
AAGTGGACGACAGTCGCCGCCGCATCGAATCGCTGGAGACCGAACACGCCATCATCGAGCGCGAGCGTGC
GATTGGCATCGTGGTGGATGAGCGTGCTGCTGCGTGTGCCGGCTTGCTGGAAAGCGAACACGGCCGCCTG
CGTGATCTGGAGCAGCGGTGGTTTGCCGAGAAGGCATTGGTGGACGAGCTGCTTTCGCTGCGTGCACAAC
TGCGTAGCAGTAATTCATCGATGGAAGGCACCGGCAGTGCGTTGGAAGAAGAGGCCGACACCGACGCAGA
TGCCGCTGTGGCGCAGTCGGCGTCTGGCGACACTGCCGTGCTCGACGCACCGGTGCAAGTTGATCGCGAC
ACGCTGTTAGCGCGCCTGCAGTTGGTGCAGGCCGAACTGGCAGCATTACAAGGCGAATCGCCGCTGATCC
TGCCCACCGTCGATTACCAAGCGGTTGCCGCCGTGGTCGCCGACTGGACCGGCATCCCGGTCGGGCGCAT
GGCGCGCAACGAGATCGACACCGTGCTGCGCCTGCCCGACCTGCTGGCCAAGCGCGTGATCGGCCAAGAC
CATGCCATGGAGATGATCGCCAAGCGTATCCAGACCAGCCGCGCCGGTCTGGACAACCCGGACAAACCGA
TCGGCGTGTTCCTGCTGGCCGGCACCTCCGGCGTGGGCAAGACCGAAACCGCACTCGCGCTGGCCGAAAC
CTTGTACGGCGGCGAACAAAATCTGATCACCATCAACATGAGCGAGTACCAGGAAGCGCATACCGTGTCC
TCGCTCAAGGGTGCACCGCCGGGCTATGTGGGCTACGGCGAAGGCGGCGTGCTCACTGAAGCGGTGCGAC
GCAAGCCGTACTCGGTCGTGCTGCTGGACGAAGTGGAGAAAGCCCACCCGGACGTCCACGAACTGTTCTT
CCAGGTCTTCGACAAGGGCTGGATGGAAGACGGCGAAGGCCGCCGCATCGACTTCCGCAATACCTTGATC
ATCCTCACCAGCAACGCGGGCACCGACCTGATCGCCAGCCTGTGCAAGGACCCGGAGCTGATGCCGGATC
CGGACAGAATGGCCAAGGCCATCCGCGAGCCGTTGTTGAAGGTGTTTCCGCCGGCATTGCTCGGGCGGCT
GGTGGCGATTCCGTATTACCCGCTGAGCAACGACATGCTCGGCCAGATCGTGCGGTTGCAGTTGAATCGC
ATCAAGAAGCGTATCGAGGAGCGCTACAAGATTCCGCTCGAGTACGACGACTCGGTGGTGGAGCTGGTGG
TAAGCCGCTGCACCGAGAGCGAATCGGGTGGGCGGATGATCGATGCGATTTTGACGAACTCTATGTTGCC
GGACCTCTCGAAGGAATTCCTTTCCGGACTGGCGGCGTCATCGAAATTCCAGCGCATAAGAGTTGCGGCG
GACAAAAGCGAATTTGAGTACTTTTTCGGCTGA